MZ@ !L!This program cannot be run in DOS mode. $PEL@2  eP |8u0 8.text v `.data4@.rsrcv<@@.relocH0 @B2 $DTfz**6B^v (@Tjz(8HZhz $BPj,>P^l $:FP\n|8Phx 0zp~  2HZj^ PDPf>@2@2p@2p&@26@2.BATsetupapi.dllsetupx.dllVersionAdvancedINFReboot][.INF "SeShutdownPrivilege...*wininit.iniSoftware\Microsoft\Windows\CurrentVersion\App Paths\UPDFILE%luVERCHECKINSTANCECHECKEXTRACTOPTTITLELICENSEadvpack.dllPOSTRUNPROGRAMRUNPROGRAMUSRQCMDADMQCMDSHOWWINDOWREBOOTFINISHMSGLoadString() Error. Could not load string resource.CABINETPACKINSTSPACEFILESIZESUPROMPTIXPIXP%03d.TMPppcalphamipsi386msdownld.tmpA:\~TMP4352.TMPRegServer&gAgruntime error TLOSS error SING error DOMAIN error R6028 - unable to initialize heap R6027 - not enough space for lowio initialization R6026 - not enough space for stdio initialization R6025 - pure virtual function call R6024 - not enough space for _onexit/atexit table R6019 - unable to open console device R6018 - unexpected heap error R6017 - unexpected multithread lock error R6016 - not enough space for thread data abnormal program termination R6009 - not enough space for environment R6008 - not enough space for arguments R6002 - floating point not loaded Microsoft Visual C++ Runtime Library Runtime Error! Program: ...LC_TIMELC_NUMERICLC_MONETARYLC_CTYPELC_COLLATELC_ALLGetLastActivePopupGetActiveWindowMessageBoxAuser32.dllunited-statesunited-kingdomunited statesunited kingdomtwnturkeyturtaiwanswitzerlandswedenswesvkspainsouth-koreasouth koreasgpsingaporerussiaprtpr-chinapr chinaportugalpolandpolnzlnznorwaynew-zealandnew zealandnetherlandsmexicomexkoreajapanitalyirlirelandicelandhungaryhong-konghong konghollandhkggreecegreat britaingrcgermanygbrfrancefinlandenglanddnkdenmarkczechnchinachecanadacanbritainbrazilbrabelgiumbelautaustriaaustraliaausamericausausukturkishtrkswissswedishsvespanish-modernspanish-mexicanspanishslovakskyrussianrusptgptbportuguese-brazilianportuguesepolishplknorwegian-nynorsknorwegian-bokmalnorwegiannornonnldnlbkoreankorjpnjapaneseitsitalian-swissitalianitaislirish-englishicelandichungarianhungreekgerman-swissgerman-austriangermanfrsfrench-swissfrench-canadianfrench-belgianfrenchfrcfrbfrafinnishfinespesnesmenzenuenienglish-usaenglish-usenglish-ukenglish-nzenglish-ireenglish-canenglish-ausenglish-americanenglishengencenaelldutch-belgiandutchdeudesdeadanishdanczechcsychtchschinese-traditionalchinese-singaporechinese-simplifiedchinese-hongkongchinesechichhcanadianbelgianaustralianamerican-englishamerican englishamericanH:mm:ssdddd, MMMM dd, yyyyM/d/yyPMAMDecemberNovemberOctoberSeptemberAugustJulyJuneAprilMarchFebruaryJanuaryDecNovOctSepAugJulJunMayAprMarFebJanSaturdayFridayThursdayWednesdayTuesdayMondaySundaySatFriThuWedTueMonSunSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDecUSVW3ۈ]]3]]]E=Pt PEPjdPu3E3PWWju uzu uWt{EPuVju tdEPjjjjMjjh j jQt=39>v.FEMu1u EG9>w Pu utV`_^[]UD$ =t =tT3vPu$#hQzuPƅ Qh?uLjt!E==r=>v3uux]SVt$ WU3ۋ>l$PU Ft?tQGPU Fu>PUEu<tCPUEt8t@]_^[3U SVWuQ=l׀"uhtEhpEEP7uuhPuQ uQj.uEGhhP\3hd]]ShXt%>tuh`EPE8tPXhj@3uPjPPhP!3EȀ8uPjhXQhMR,{jVhThHh@`t&E $8uPu׍QNE%$8uf=~QP4t$PhHV j.uDtthP\udPXhXVj@ujjjjhj 3PhV uXPX Vj@3uPjPPhPd 3OPTt-u)PVׅt!;thpVPSVPuV׋E 0_^[] 3Pj@PhTh!PÃ=,{Vuf~P5~~t^UVEPj(dPu3PjPPhP`E3PhxVVMEEVVQVuu VjVVh3VjuVjVVhV13^]D$Vu'uHD$ujj@jhTh"ju uf=~u jj^= t9D$Ph?jhh$uh t$t$UVEWMP3QVh?VVVhh0  VhW EPjjjWu,u F|ρuu hP5zpuu=XP׋h0Vj@3uPjPPhPuChPhVV@PVjjh u(uV`_^]UDSVWu>VPlhP=P׍QPVPlt[hPtthPt^PQhTQjQ//PQhQQPS|ISxVt_^[]VWt$ VX<;vWV8\t\GD$8 u@8 tPWl_^Vt$t)VX|F<:u~\t >\u <\u3^D$VW3hPt6D$hPZD$j@PtjVWW_^UVE3Puhu4u#EPVVVu u,tuuE^]UVE3Puhu4u'VEVVVPVVVVVVu8tuuE^]L$3t tt"hhxh@%t$+D$@t$Tujt$D$hPu3PjPPhP$*D$<UD$ ${pVW3u3VEjV+j PEE P= PhVu=jEj j+j PEE P`= PhjKHuChMj@E+uj Q3P= PhWu =${_^]U SVW3ۋu}?#GP<EW P ESWtohEPlWPnEPhSQh$u?EPVSShTu,uuu V u VuWV_^[] U4SVW3Euuu9p|BuuEȋE荼EPuu  EPu ؅SjBEPEPSuu tvEMPQhut]}tW3ۋU7wr rDȋEwwp pDЃ|ƃ}|}~ }|q}kuEǃ8u3xu-x u'xu!EEEEzhGh jhP3==u3PjPPhP~3_^[] =NthN)f=Lu t u3u3#u3i0u3hu 3PjPPhP0${3Z=Du H u3Df~P)=<~u= u u3f=Lu jt$(t$jt$ ({$U|$ u}u }tuuu u5({,]UD$ Vt"=tE=3=l u&jjhh4u<l HG3r4Pu5~VuLhDu8u4h2Vu0P}uj}u jux^]Vt$t#VX|F<:t >\u <\u3^UD$ SVWt=t=tm3juPuVhDV8jhhh5V<f=~jh6V0PDEt =6hWuh5V@WWTu=j3j SWhJV3SWuSjSWhVhTWW#u3PjPPhV=\u=\tjPh$j3PjPPhVqjux${{hzhHEhP u3uWjWWh=h8BuhHEV t4h8Bh5VLu3WjWWhVWVx_^[]UD$ t=t=tD3oj]Pu hDu85h8uLu4*Er"v=9uuux]UD$ Vt+=tA=tU==b3zju5x]}Nj4E4Pu =,t?h ;jhdVu0PHhjheVu0PHhD3u8h@EVVhOVV0BVjVVhu* V}\Pj4j jhThP tt\PK\P50BP3juxj0BPuux^]UVW33hEjWPjTu=jEWWWPt*}u EPPjEWWWPuօt_^]USTDžTVW3Pu }dtt}sf~6Xf~,0wf~r u\3s 3,0}f=~_@t_Ef`fEEkp0\XMDkpp \XMDL|XDPu0uEkM9Hw/9H(uEkM9Lv8u2EkM9Ls"}t}tE}<Lu*|t$EPPhQWYu M]MtLt3PjPPVPEMuMk<PM8C4s08}Lu tv#3PjPPhP${33۾E}3]ED8VjEPhd9uu f]u }u fEu}u fEu9]f9LtWf5Lt E\LtEThPuKhP\tu9]uOhPhHu53PjPPhPy${3hVPl9uuDhPh88VPhP\6EMPQRf95~t98t 9]uZ9]90Z9]$h,E%\h Wf ~qfM܋U]ȉUЍ9H LU؉MEDEtM$tM$tM (URMW<VS"EPu9u`E}S_^[]3PjPPhP${33PjPPhP${33PjPPhPy${333PjPPhPUu`${+3i3PjPh,hP%u`"${393PjPh hPWu`!${3u`${+33VhQVPVhVjQuhVyu`3UL$VW}3E3Pu VVj VVVQVtljuEPu95@u)t uE%=uEju uu ${3_^]SVW3SShx@Pj@uSjSShS{GVWhxu3PjPPhhWt3Pj@PWhP9W`_^[Ã|$ut$jhft$H3U,SVWhh=V׉EhV׉EhV׉E=hu9hWhWXPW8\uSW8:t3ۋEMU Mԉ]؉]ܿhMQUEEB}UE;tWPU8ht WuluUVE8@+V3PjPPh 3PjPPhu3_^[] U0SEVWPuhu؋}+u+}ԍEPu h]E+]+EuEdjEPHj EuH+މEuu`ËM+y3 ;E~M+΋E+Ǚ+‹Uy3 ;E~U+j3PPRQPu\_^[]U8 SVW}LIhPu u!hEhDPuX]tUSX}WXPXdVj@u SWPV~}tEWXPXdVj@u|WPV 2PX@Pj@uDPVlutE E PhDVuXV`_^[]USVWj uj4Pj;EwK} tDu3>j uj4PjPu3P_^[] Vt$ tt$Vt$zP ^ UVW5XuuG;} |3?u}WlWր|\tWր|/tWW8\D8uWP_^]jhjjjht$ u3 PVWt$ Vtp=uWLuNj4j5h-6Ph5ztt=9t 3 =t hV_^Vjj@3uPjPPh4P3]t$X@Pj@ȉ3u PjPPh4P[V`3t$Ql N5^UD$ SVWt|t@tt"%%jSVjjWu utujSVjjWu _^[] SVt$ Wt[3ۍ~<:u ~\u~\u <\u~?t/?\u:ttKjV\W 8u_^[U0{SVW38t F=~r(u!3PjPPh54hhuuFE u63k040{ǁ4{8{@{<{:5uu uQkD{t30{4{_^[]UL$k4{VWtt1E_^]jEPuu D{u׋Eҍ<{@{}2+;rNj} 8{ȃU\VP:=tnjEPEuu kD{tut=5=,t. 4t$jkd+5Phh:Q<^]Vt$k4{u dž0{38{@{<{!D{t dž0{3^UT$kD$4{u=t ttU<{E <{E <{@{E -t-t,t.EPju D{u]3ܸոUVuk4{u3GEPuu $u3/EMPQ tEPPPD{@^] fL$ft3f't$jt$øU=Vt}uu vNiEt#t+t-83?u <23+=4u tvh754LvhhQ'u Pu3hhP u Pu u vhhQuXfFfNPQv u;v fFPTPQ$@u uc^]V Wt$ =lv RvhvhfF_f3fN ^f U3$VW}EPjhLhKh,KhJhIh9Mh,Me$tehhhh7 tGEPWVf t549Eu+}u%}uWtVe@3_^]SVW|u3m4t/jhBP0Plj4hAP0Pl0Pu34VjVVhPh8jhLhKh,KhJhI3h9Mh,Md$؅uV8jVVP548Qh03WhJMWhThhS-ft*SduW8jW3WP5439=0t0P=03u9uPjPPhPLu$uj4VhPH_^[VW3VVWj 4WV4PVP_0^@j$h{h$t3PjPPhP${f {39 {uPjPPhP${6jh(hMhcu3PjPPhP3SVW3SSh@Pj@uSjSShSpb${VWhu%3PjPPhP?W`${VhWuW`:j3j SWhSW`u ${ ${3_^[ÁVW5t?=<u= uh667v`W`uf=~t=8t398tR9<uJ9 uBD$hPl$ t D$P8hD$P_^USVW33u }`SChQ uVlQVVtVTujVt =8u*Vjhu(tVjV_^[]U(} VPu)Phl$ tGEP,E܅tttt$h h hhhhThuhlVujVt+83Vuhmt5${(K ${398th8t3^] USVW3SShH@Pj@u!SjSShS ${3VWhHOu*3PjPPhPW`${3hWu  W`=RtP=R\u=S\tPjhRt J3PjPPhP.31=< = Vht?jjVt VujjV{t h$P3۾lZUP8tuPTu`uPAtGBt>EMPUQERPQ0tEEE=sshSjPu.PuSjPu 'PthPhPPLujPPVlSjVHhPjjP[33PPh3Ph5z _^[]U+SVW}уQj@3uPjPPhP}++ȃ(++ы+Oʃ3PhjPPh@S S`t*VuTtt${  ${3_^[]U3$SEVEWE} E;HPh@uVu#3PjPPhP${3 EMPUQER3PS0um3fRS${hPSPShSjPVhSQ33ۍESMSPQSSSS<um3fS${hPSPShSjPVhSQ3PjEVPf3uuκM;t f@f=rf=u3PjPPhP/3$t#Et(4{((4{ǃtt2;vRT8:=`t `Pj{ u<:,"<ESXj[S{tj]Slj]SYtj[SJ{EEEPScEEQhVlG:8,"<ESX EEEPSP TEu'ERQSlhTSENQSlhTSuDy:jZQC{Et Gt3D HuufL:P1tAtUfLfLu w:uztVQCAtItNtSt" %% u@Ph8\t3?Z3K3=Dt7=Ru.hRWzPptj\W<@3_^[]D$hPu 3PjPPhP~p${3D$jjPeÃ|$t^u>${ 2D$ȁut ${ %t${t% U ESVW3VEhP Ej Pj4tiPjPt2O_ESMXDPSuuUtWF${EEWE_^[]VW{D$ +D$ +# {rϸ_^USVW3h}PluQWhjWWh@Q tjEP}WuSt;}t ${R3tS_^[]UhPluQ*QTtujjPD u]USVWju uV4t1PV؅t#EujPuuSVpSu3PjPPhP}_^[]VW|$ WXNj5PWPW;v 8\t PW;w8\u P _^dUjhHhzPd%`SVWeT"3"""-"%"""u j?u j,EP X p t = u j 5 <"t < v5F> w-F>"t&]؊t3P<tFF>"u>"uF>t > wF>uEEPLE tE%PVjjHPP,'EEEPEPCËeEP#EE_d^[]̃=| uD$Phx ̍B[...3D$ST$t B8tфtQu WV ؋ ~333ƃu%t%uu^_[3ËB8t6t8t't8tt8tt^_B[ÍB^_[ÍB^_[ÍB^_[UW}3AOE G8t3_̃|$SVt$WUt -FL$L$l$+ڋ+ȃ vW0FuNNG;r]_^[ËD$ Vt$ jL$ PVQ^̃=(VWuD$ a|WzR _^Ã=tj|3D$ P%tj_^Ë _^̃=(S\$ua|z [Á}0="~ jS 3fYu[Ê3Ҋѡ DPtL$D$ \$ \$D$ L$jj(QPD$PhRu[Ãu 3D$[33ɊD$L$[ ̋L$SA=w 3fJ#D$[Ê3ۊڡ DXtT$D$ L$ L$D$ L$jjQPD$Pjou3[ËD$%#D$[̡thh6hh$ËD$jjP2 ̋D$jjP SVW="t$uVdP\"|$\$"u?=t$=;=rtЃ;=shhfh$h Tt 8_^["VX_^[j yj VW|$t$ ;vtЃ;w_^USVWUjjhluH]_^[]ËL$AtD$T$SVWD$Pjhld5d%D$ Xp t.;t$$t(4v L$H |uhD@Td _^[3d yluQ R 9QuSQ" SQ"MKCk Y[SVWUG L$FPPQ7Pu@]_^[Ãu ]_^[Ë~TL$NTxx# |#;~% [nP CD -|#-x#;^X=u FX^=u FXN=u FX>=u FX.=u FX=u FX=uFXFXPj҃^X@@P҃]~T_^[ËL$Qd]_^[̋D$VT$9t # I ;w+ƒ#^̋D$jjP 33ɊT$#L$ u D$t 3f U #ȅu3ø̃p SVW3U:t:=tF+р:uPe"؅u j -p ŀ}t^+щL$}=t=Q"u j ++;ȃl$}up Pfp ]_^[̃VWhPIVjp 5"8t5 D$ L$PQjjV^D$D$ PZu jD$ L$T$PQPWVD$H="_"^̋L$ST$Vt$ WD$U|$t T$D$>"tFt@F3ۊ#t t@F t t u˄uNPtL@FF>"t0t*3Ҋ#t tF@t@F>"ut@>"uF3> t uF>|$t T$D$T$ 3Ҁ>\uFB>\t>"u"ut n}"u3ۃJtt\@JutOu tF tAt7t!3ۊ#tF@@FPq3ۊ#tFFYt@|$t T$T$ ]_^[ÃSVW3U35x9#u6;Ët #"p؅t # 3]_^[Ã=#u֋u 3]_^[f?tf>uf>u+jjFjjVWjj|tAU؅t2jjUSVWjj|u S3Wt]_^[Wt3]_^[Ã=#u{up؅u 3]_^[Ë;tE}uE}u+EUD$uSh3]_^[Ë|$ShD$]_^[3]_^[̃SVWUjr D$0P9-$uj 3]_^[Åuj 3]_^[D$$9(0D$=%rD$PUY#3@󫪃|$t$8D$t,Nt%33Ҋ;r#@3ɊN;s>uԸ#@=rU-$#3@󫪋L$It1Nt*33ۊ;r$#B3ۊ^;s>u@rU-$$$D$@$j@$IZJB 3]_^[3$$j$3AA 3]_^[Ã=$tj3]_^[j]_^[$D$u$%u$%u$(̋D$-w3Ɋw$w3øøøøvvvwvW3#@󫪣$$_$$AAj̃DSVWUhu j5 ;v(3ɺ N$FVN;wߍD$PLf|$B|$DD$D(Xt|9-}^h tB ;v"3ɈH$@@ H€;w9-|-3~It9t3u Qt$Njσ ʉQGC;|33ރ;uWCtGPt(Ut%+uK@uK K@K$Gl|P]_^[DVJ%u3^jtj] t0V%PtVF^3^ËD$@P#@VW%PuGjtj t+W%PtWG j@V_^jhj u3 u P3øVC20XC00USVWU] E@EEEECs {ta v|tEVUkT]^] t3x<{SkVS vjDeC T{ v4롸UkjS]]_^[]UL$)APAP}]̡| t u.= u%hh&th́3ɸ%S$VWU9t A=h&r9%=| _=| u = I$hP-pjՅu,$f$$+уUjt-D$ UL$ VPQjWltL$$QPD$ VPV]_^[̃Vt$t\j -D$L$ PQVz t"L$PD$PQ j i^j Z VjP^̡;L$PQVWt$ v3_^Åu|$w V#utVu3_^VW|$ 9=0r-j EPGj t_^W jP_^SVt$Wt$Uwt3wS;50w:j Pj t3΃u.V jPӋu=;tVu3]_^[Ë]_^[̃=0SVWUul(j=h h@j׋؅ jhhSׅ(uL=(u ((=(uI((=h jP|3]_^[((F5(F03nF <.}GOE|3@󫋆;v-CS;w݋]_^[hjS(tV jP3]_^[Vht$ jP950uF0(t!NVjVP Q^0^̃SVW5(UD$?;u?h@hPt" 0F t;}n D$L$t MK}|$Ƌvt.xu(H9u BA|u P;5(t |$>]_^[̹(T$t ;v @;w (u3ËD$ʁD$ +щD ̋L$D$+ L$ Pƀxu0=0 u j~SVW50\$U~}T L73;w4t/3Ɋ7;v"SPP' 7G@|339n~LL73;w4t/3Ɋ7;v"SPP 7G9~6;501(39t9N un6(uf Z0 +]_J^(X[]50(\7~_^[]50(\7~_^[ËV J|G;~8D7uG;j h+ PP;n ;}0JE L5;ƂAƁ|Չ50}8D7t G|N F }~ ы ˆXN(\1 ]_)X^[3]_^[3]_^[̋D$ST$VWHU8;r34:;s)P @H+]_^[π9t4*;t$Mu-M9uAC9t;s1;uX+;w3ۊ*;r=3]_^[Í4*;s +ډ0X @HU+]_^[ÍhX;v@*;w3Mu"M9uAC9t;s"+;w3ۊ;w3]_^[3]_^[Í4*;s +ډ0X @HU+]_^[SVW3950uBh؅tnh=Sף0tWhSh0Sף00tЋt=0t V0D$L$T$PQRV0_^[3_^[̋L$ WtzVSًt$|$uuo!FGIt%t)uuQt FGt/KuD$[^_tGIuulGKu[^D$_ÉIt~Ѓ3‹tބt,tt uƉ3҉3It 3IuuD$[^_̃=(Vtnhj:u^VtVV^á15<P1P351^<;1P1Pu31^SVW3f@1U3t$f=>1u ]_^[ÍFPj1WjFPj2Wj F Pj3Wj FPj4Wj FPj5Wj FPj6Wj Vj7Wj F Pj*Wjx F$Pj+Wje F(Pj,WjR F,Pj-Wj? F0Pj.Wj, F4Pj/Wj FPj0Wj F8PjDWj FWj 荆Pj?Wj 荆Pj@Wjn 荆PjAWjX 荆PjBWjB 荆PjCWj, 荆Pj(Wj 荆Pj)Wj 荆PjSj 荆Pj Sj VSX ]_^[Vt$$FPFPF PFPFPFPPF PwF$PkF(P_F,PSF0PGF4P;FP/F8P#F <A <Au _^[<_^[3""̋T$S:t7<0|<9 ,0B:u[<;uH9u:u[B:u[̃=(Vj0jYu^VtVVV^á<<PV<HN15<R 1Q351^á< <P<1HR<< < 1QR31^SVt$ WU3f=41u ]_^[ÍF PjWj؍FPjWj ؍FPjWj ؍FPjWnj UjWj ؋EPF PjPWjx ؍F$PjQWje ؍F(PjWjR ؍F)PjWj? ؍F*PjTWj, ؍F+PjUWj ؍F,PjVWj ؍F-PjWWj ؍F.PjRW/j VjSWj ؋]_^[̋T$S:t7<0|<9 ,0B:u[<;uH9u:u[B:u[Vt$t[F =<tQPFP{FPoFPcFPWF PKF$P?^̃SVWU3|$9=(R9=(u!h(3f,1j PWhThEh6h'D$3A@=|D$ (PQm|$bD$%"~4|$\$t)St"33Ɋ;|@3ɊK;};ujFjPhWjfL$3f@=|jEL$jPhQjfE="~<|$\$t1St*33Ɋ;|TFf@3ɊK;};uύFM  =1t1PH=151t1P+W-1D$P3]_^[Ët$l$VUWD$P]_^[ø  1Q   1Q311]_^[3UV3PPPPPPPPU . tB$uA tF$s ^UWVSM&ً}3ˋu F3:GwtIIы[^_UV3PPPPPPPPU . tB$u t F$sF ^̃=Vu =} jP~u)jj~u j(@93~L P|3ҾP9‹ʃ ɋtu B9r^="tUWVu }M;v ;uRу$@<,ffFGE^_ÐffE^_.E^_Ð v#ڃ+ʋȃ$.E^_.u_у$ޢآȢfFfGFGE^_ËfFfGE^_ÊFGE^_ËNO v%ڃ+ʋȃ$E^_j JtL$QЃtj j 3̋D$SVWUt$3ۍD$S$h$PQWuVz$SSSPW;tjU-;t[j$UVPW]t=P$t%UVPf t Vi3]_^[ĀÅt VO]_^[ĀÅ$j$jhJPWu]_^[ĀË$J9"D$~j3D$P3ɋ 3fJt L$Ȁ0Jr3]_^[Āø]_^[ĀS<VWUu;j5jjjօt&jjjjt 3]_^[Ë5<uD$ L$T$P\$QRS]_^[ã<|$$u=(D$j\$jPSu3]_^[U*u3]_^[ËD$UVPStD$ u&jjjVjWlu(Vt3]_^[PD$ PjVjWltVL]_^[S<VWUu;j5jjjօt&jjjjt 3]_^[Ë5<uD$ L$T$P\$QRS]_^[ã<|$$u=(D$j\$jPSu3]_^[ÍmPu3]_^[ËD$UVPSt%D$ jju)jjjVh W|u+V63]_^[PD$(PjVh W|tV ]_^[UWVSu }(xu; t.F'G8t,A<ɀ A,A<ɀ A8to= jj$3ې t'FG8tPSO؃E8tX u  j[^_SVW3Uj^9-~j 5~8tG@ tPtCP|-~8 P֋ ~9R ~9E;-|jR]_^[Vt$V5t^F @tFP^3^SVW3|$G Ȁu<t5G+؅~*SPGP= ;uG tG O GG_^[j ̃SVW3U3\$j93t$~(te@ t_PW~ (A t4uQt!CutQuD$~ (QWG;=|t$jÃtD$]_^[VL$3=9t"F=?rr"$wO^ B =^Árw "^^ ̋D$L$ ȋL$ u D$S؋D$d$؋D$[̃=(S\$uA|Z [Á}0="~ jSҾ 3fYu[Ê3Ҋѡ DPtL$D$ \$ \$D$ L$jj(QPD$PhRu[Ãu 3D$[33ɊD$L$[ VWt$ F @t F _^VVV9_^VWt$ F tBVVnFPb}FtPFF _^SVt$ W;5sƃƃ jT$0tSNu~fC|f%f=ukbjT$0u[jj P luAUjT$0tSu7fC|f%f=ufffHfD$tPStPSǃǃD$]_^[jj PG jj P6 ̃(SVWU+l$<+ȃ|$@++ы+OhhSU hhSU vD$j$PQU $tjEjPe 3]_^[(Á|$MSCFtjEjPA 3]_^[(f|$,t"D$,M%PjQ 3]_^[(fL$Hft-fD$Df9D$4uf9L$6tjEj P 3]_^[(Ít$}P 3f\$\$En\$D$jPQU tSEjP 3]_^[(Áu9D$%t(PUELujEjP? 3]_^[(Ët0VELPQU ;tjEjP 3]_^[(3D$}Du.PUEDuujjP 3_^fW_@^Vt$fw3Ɋ$jjP 3^ËF4Pt=jjP~ 3^ËF4P~tjjP[ 3^ø^ËFQDICt^É5VV3^ËD$PP̋D$PPVWt$ t=vD$ |$u3_^j T$u_^ËL$HPMDIC3_^̋D$8MDICtË@T$ H ;sËL$PD$PRQyu D$P̋D$-MDIC̋D$8MDICtPP3S\$ˈHPbt+أFt!أpS3[ø[fL$SV3f;f) D$5+f#fIfteB59u9u ffIfu^[f^[f  9u ̋D$VfL$3D$ 5L$  5ԣE%f95t95ԣuf95u&=ԣu=u=uf3^f^̃=u PR3  ;uJP̃  VW9u3_^áhT$ hD$RD$*D$ Ku3_^á K} KKPYKuK5PV3_^33=K9=K~Aht@8 KH9=Kt KKFK95K+_^Ã}3_^VKt3҉HP @u39 K~"33KAtKt9 KjjmKtKK^S3fVft$ WU;tf)5=+|$j#=K HQuf]_^[f0ޡK+K;~؋Ǚ ȋǙ3j+Q%3+‹L(+;~f+#=Kt'KA-KEKu١K9Ku9K@@9K3jPKt<KKf]_^[f]_^[f]_^[f]_^[f K KK9 KuRK@@9K3jP?KufáKKKSKVWt$UtM9Kt9HJHt K K KHKL$]_ H ^[áK9Ku3]_^[ËK{tq K{ t^/j KUPP ;t3]_^[hCP KQ-U =t3]_^[Ë KDK KAKKSKKK|tNj KUPP ;t3]_^[hCP KQ-U =t3]_^[ËL$u 3]_^[ËL$]K 7_^[VKPTKtpP?ƅuK5PV^́3SD$VW$U󫋔$$ʋ1Hu$9$$u]3_^[ĄË$8uA$;vL$ ;s޿$8uO$;u|$<;vߋ$D$@;s!()l$@x1Al$@;ωl$@r捌)D$@y ]_^[Ąø]_^[ĄD$@$3ɍ$O$tMOu3t@G9$w3$ӉD$$|$4D$LD$ډD$9t$|$h?D$j hih@hp@jjP 3_Āj?P ?Qhihjf|$SVWUtizlii5i i+ȃsIz9zru3!3=Kpiz3z3Ҋ rփsIz9zru3!3=Kpi-z3+z3ۊ rց;t ]_^[Ã39Kpiiziz9|ir)=z)|i]3_^z[á|i=zȃli|i+z]_z^i3[|iø]_^[SiV iWsHz9zru3!35K=piz3z3ۊ Ӄ;rIdisIz9zru3!35K=piz3z3ۊ Ӄrƒi i=Kt _^[Åttt _^[j1_^[_^[\_^[̃=?ut?D$f8CKtÃ3ɣpi zD$ iT$z iD$ zzhi3 di K liSVt$ W|i9zs z|i=|iliw$_^[j139diuR9|ivJt_^[jtiP xiQiRiP3_^[f+=|i_3^[2(\L$SV3W3A~ l|333;~"G}}A,G|3804+ЉQA@pv@p`P@HtdTD3@+ЉQ(A ,@Hv3+ЉQA@`v3ҹ+‰A+‰+‰Q Bv_^[̋T$ S VBWrUHt$BB2~+VBVHVu3~IP;~P^l $:FP\n|8Phx 0zp~  2HZj^ PDPf>kFreeSidiEqualSid AllocateAndInitializeSidGetTokenInformationOpenProcessToken AdjustTokenPrivilegesLookupPrivilegeValueARegCloseKey RegDeleteValueA.RegOpenKeyExAARegSetValueExA6RegQueryValueExARegCreateKeyExA-RegOpenKeyA1RegQueryInfoKeyAADVAPI32.dllLocalFreeCloseHandleLocalAllocGetLastErrorGetCurrentProcesslstrcatAGetFileAttributesAlstrlenAlstrcmpiAGetPrivateProfileStringAGetPrivateProfileIntAlstrcpyAGetModuleFileNameARemoveDirectoryAFindCloseFindNextFileANDeleteFileASetFileAttributesAlstrcmpAFindFirstFileA_lclose_llseek_lopenUGetWindowsDirectoryA*CreateDirectoryA5GetSystemDirectoryAkGlobalUnlock`GlobalFreedGlobalLockYGlobalAllocLoadResourceFindResourceA8CreateMutexASetEvent.CreateEventASetCurrentDirectoryAOTerminateThreadResetEventCCreateThreadQGetVersionExAFormatMessageAFreeLibraryGetProcAddressGetExitCodeProcessvWaitForSingleObject=CreateProcessAAGetTempPathALoadLibraryAFreeResourceLockResourceFSizeofResource1CreateFileAReadFileWriteFile!SetFilePointer"SetFileTimeLocalFileTimeToFileTimeSDosDateTimeToFileTime?GetTempFileNameA7GetSystemInfoGetDiskFreeSpaceAGetDriveTypeAlstrcpynASGetVolumeInformationAGetCurrentDirectoryALoadLibraryExAGetModuleHandleA,GetStartupInfoAGetCommandLineAPGetVersionoExitProcessNTerminateProcessRtlUnwindXUnhandledExceptionFilterFreeEnvironmentStringsAMultiByteToWideCharGetEnvironmentStringsFreeEnvironmentStringsWGetEnvironmentStringsWzWideCharToMultiByteGetCPInfoGetACP GetOEMCP#SetHandleCountGetFileType.GetStdHandleLDeleteCriticalSectionGetCurrentThreadIdSTlsSetValuePTlsAlloc&SetLastErrorRTlsGetValueqHeapDestroyoHeapCreategVirtualFree~InitializeCriticalSectionXEnterCriticalSectionLeaveCriticalSectionLCMapStringALCMapStringW/GetStringTypeA2GetStringTypeWsHeapFreemHeapAlloccVirtualAllocGetLocaleInfoAGetLocaleInfoWFlushFileBuffers1SetStdHandleKERNEL32.dllGetDeviceCapsGDI32.dllEndDialogMessageBeepSetDlgItemTextALoadStringAGetDesktopWindow~wsprintfAExitWindowsEx%CharPrevA"CharNextA2SetWindowLongAAGetWindowLongACallWindowProcAGetDlgItem SetForegroundWindow8SetWindowTextASendDlgItemMessageAGetDlgItemTextAEnableWindowSendMessageAPeekMessageADispatchMessageAMsgWaitForMultipleObjectsMessageBoxA5SetWindowPosReleaseDCGetDCDGetWindowRectDShowWindowDialogBoxIndirectParamAUSER32.dllCOMCTL32.dll VerQueryValueAGetFileVersionInfoAGetFileVersionInfoSizeAVERSION.dllWEXTRACT*MEMCABrundll32.exe %s,InstallHinfSection %s 128 %sSHELL32.DLLSHGetSpecialFolderLocationSHBrowseForFolderSHGetPathFromIDListDefaultInstallDefaultInstallDoInfInstallSoftware\Microsoft\Windows\CurrentVersion\RunOnceSystem\CurrentControlSet\Control\Session ManagerPendingFileRenameOperationsSystem\CurrentControlSet\Control\Session Manager\FileRenameOperationswextract_cleanup%d%s /D:%sCommand.com /c %sWEXTRACT*MEMCABrundll32.exe %s,InstallHinfSection %s 128 %sSHELL32.DLLSHGetSpecialFolderLocationSHBrowseForFolderSHGetPathFromIDListDefaultInstallDefaultInstallDoInfInstallpk   ((((( H .  x `y!@~ڣ @ڣ AϢ[@~QQ^ _j21~  ` <X0xyxzhdTC|~pp&dp&`Xp&`Lp&Dp&CCXJJJpJ(((TL 8 $      |xp`\X T P H 4 (                     x t l\ LD@4( |d`\XPLD< ,     T==++  77,)VV**-x1-x,"fpf!h!d,\1XH,@<T4(TT@$$ baab''QQRR44@@//@@00_VxVt_Xl`A\AD*PRDR<"8*4.,. )vZ Zv,,,            xtplhd`XPH<0( |t`X;.<<<<<<<<<<<pPSTPDT<0=        ! 5A CPR S WY l m pr   )    ;Zx0Nm:Yw/Ml      #+3;CScscc !1Aa  0@` ?? KH` K KK 8PhK?BLMPRS(U@KXp&:N^z0H`xK KK K K K K K (K 8K HK XK hK xK K K K K K K K K K K (K 8K HK XK hK xK K K K K K .(,@\lh@4 @4 $ =` d $         >$! ,! "P! AVIADMQCMDCABINET EXTRACTOPT FILESIZES FINISHMSGLICENSE PACKINSTSPACEPOSTRUNPROGRAMREBOOT RUNPROGRAM SHOWWINDOWTITLEUPROMPTUSRQCMDRIFF.AVI LISThdrlavih8G\AN<H3ȅXLISTstrlstrh8vidsRLE @B('strfh(<?vedtJUNKLISTv$movi00dc(                                                                                                                                                                                                                                                                                                                                              !                               "                             !                                                                                                                                                                   00dc$## % %$#        00dc$$$$$$%%"&      00dcR$$ $ $ #))(""           &&&00dc' & # # # # " "  # $  $  $  % % % & & & 00dc\. , * ( ' ' ) *  *  + +  +  ,  ,  ,  -  -  - 77700dc$6 4 2 1 1 3 4 4 5 5 5 6 6  6  7  7 7  CC00dc&= < > ? @ @ A A A B B B C  C   C  RRR00dc$L K M N O O P P P Q Q Q R R  R  ```00dc Z  Y [ \ ] ] ] ^ ^ _ _ _ `  ` `  nn00dc$h" g i j j j k k k m m  m  n n  n ~00dcv# v v v v v w w x x y  }  ~  ~ ~ 00dc{# { { { | | | } } } ~      00dc $                00dc<#                00dcX"                  00dc                        00dc                         00dcz                          00dcr                           00dcb                      00dc8                              00dc                                  00dc                00dc00dcidx100dc(00dc400dcR00dc` R00dc 00dcB \00dc $00dc&00dc$00dc, 00dcT$00dc00dc00dc 00dc<00dcX00dcn00dc00dcz00dcr00dcb00dc 800dc8" 00dcL#00dcb$00dcl$PA( @33333330{{{{{{{330{{{{{{{33330{{{{{{{330330{{{{{{{330330{{{{{{{330333333330ww33?0303?07?00333333330?730DO0fODDnofowwwwwwwwwwwDDDDDD@DDDDDDGpwpDDDDDDGpwpDDDDDDDDDDDwwwwwwwwwww????( 3330{{{33{{{33333?03333??3w3fOODDDDDDpp{{{3333{{{333333wʀLicenseMS Shell DlgPPlease read the following license agreement. Press the PAGE DOWN key to see the rest of the agreement.P v4PDo you accept all of the terms of the preceding License Agreement? If you choose No, Install will close. To install you must accept this agreement.P2&YesP2&NoʀBTemporary folderMS Shell DlgP<Please type the location where you want to place the extracted files.P 5P26&Browse...P.2OKP.2CancelPAʀ4Overwrite fileMS Shell DlgPDo you want to overwrite the file:P8P"2&YesP@"29Yes To &AllPy"2&NoʀTExtractMS Shell DlgP>2&Cancel@0AExtractingP-07P0BInitializing... Please wait...P>:msctls_progress32Generic1P$;SysAnimate32User1PAʀTExtractMS Shell DlgP>2&Cancel@0AExtractingP-07P0BInitializing... Please wait...PAȀ_WarningMS Shell DlgPL2>E&xitPIL2=&ContinueP ?P 4RDo you want to continue?PA4Please select a folder to store the extracted files.%sDEBUG: <%s> <%s>CFailed to get disk space information from: %s. System Message: %s.&A required resource cannot be located. Are you sure you want to cancel?8Unable to retrieve operating system version information.!Memory allocation request failed. Unable to register window class."Failed to create requested window.#Unable to create extraction thread.3No valid folder can be located for extracted files.Cabinet is not valid.Filetable full.%Can not change to destination folder.Setup could not find a drive with %s KB free disk space to install the program. Please free up some space first and press RETRY or press CANCEL to exit setup.KThat folder is invalid. Please make sure the folder exists and is writable.IYou must specify a folder with fully qualified pathname or choose Cancel.PA!Could not update folder edit box.5Could not load functions required for browser dialog.7Could not load Shell32.dll required for browser dialog.Installation failed.(Error creating process <%s>. Reason: %s1The cluster size in this system is not supported.,A required resource appears to be corrupted.QWindows 95 or Windows NT 4.0 Beta 2 or greater is required for this installation.Error loading %shGetProcAddress() failed on function '%s'. Possible reason: incorrect version of advpack.dll being used./Windows 95 or Windows NT is required to installCould not create folder '%s'To install this program, you need %s KB disk space on drive %s. It is recommended that you free up the required disk space before you continue. Do you still want to continue?Error retrieving Windows folder$NT Shutdown: OpenProcessToken error.)NT Shutdown: AdjustTokenPrivileges error.!NT Shutdown: ExitWindowsEx error.}Extracting file failed. It is most likely caused by low memory (low disk space for swapping file) or corrupted Cabinet file.aThe setup program could not retrieve the volume information for drive (%s) . System message: %s.xSetup could not find a drive with %s KB free disk space to install the program. Please free up some space and try again.eThe installation program appears to be damaged or corrupted. Contact the vendor of this application.&FDI Extraction completed successfully.Cabinet file not found.Cabinet is not formed properly.VCabinet data is corrupt. This executable is damaged and installation is not possible.FDI memory allocation failure.#FDI compression type not supported.FDI decompression failure."Unable to create a requested file.Cabinet reserve size mismatch.Wrong cabinet file.FDI user canceled or halted.;Command line option syntax error. Type Command /? for Help.Command line options: /Q -- Quiet modes for package, /T:<full path> -- Specifies temporary working folder, /C -- Extract files only to the folder when used also with /T. /C:<Cmd> -- Override Install Command defined by author. sYou must restart your computer before the new settings will take effect. Do you want to restart your computer now?sYou must restart your computer before the new settings will take effect. Do you want to restart your computer now?eAnother copy of the '%s' package is already running on your system. Do you want to run another copy?You do not have administrator privileges on this machine. Some installations cannot be completed correctly unless they are run by an administrator.uThere is not enough free space in the Windows temp folder or in the current folder. Please enter a new folder below.6The setup program is preparing to run. Please wait...:The folder '%s' does not exist. Do you want to create it?hAnother copy of the '%s' package is already running on your system. You can only run one copy at a time.OThe '%s' package is not compatible with the version of Windows you are running.SThe '%s' package is not compatible with the version of the file: %s on your system.PMSCF=, g, Flash.ocx g, SWFlash.infP g, ADVPACK.DLL g, W95INF32.DLL  g, W95INF16.DLL,I-ICK}|0<;$KfAb5qa,l! 4nQ#`l2\UE-ъU+ B@ZI XoHD@dsn?_f~{{9~{S8]iKĿ_2WS%b}?p?"߿0}pO# 0`@Re̓ñms{{Cްd6G`S>8@ +5#EfEF_bߑ,| R3}g>@ 7͒Q3>ƥ\lq+Ef{q8DJhOrc 8Y9Kp'rw["//6褋gG /,`/K7,Yp|}Wkֽ1P U h|/ 3 c)kQf8&ϼ]/5n%`QmaO%7~K.~7ڔߗ/O~?~%2nDIH=$ w|;v (XO-d ɓAI]fs[ !XB:*`H\k`uU~}pD8riNNrevNIWĚy`0B? =ol>-\YsUvNIrͲ]Xr,sVKK8D>.07xaXc 21:w-/'S2Rs%ED,D uf,YNU2\>%5Q?!]+ rz\$ }%2IPYZoTZOI38~1~ƚ͠ 1!~9sJr{^54mÆCOs% %\oFi/%S]nAXb紬"mOЧ֕^#j`g6\}W:gPz5Kt0`2[,$Ak.9H.t'mT 0=CLWqvNX+2]"I|R,*Zpm$5|VF}mrSmm/qtIM&*6NJ+t 9+vWd$AѶC{d5]ip"!x_-d,mb.V ɩl"݉ȅG|WĪ6 FsGL`Dx[totӢ[V Tĭ\^ll&^#Joh5YNy{\5(R >-.hTO?<|Ra%cŭ]É7ZyNWu)vcֈ t@BE-D]:?2`TW+nOqr2 X.2DCy ;'G׎>2ֲ^, ܞ [st%U [ G=(ܧ j@uL5%D0ANN`bXX[ AlΞDqHlJ6t*(@ F>W9pI*|rwC CsRx@uIU9kC ,+t8 $J/jJwg0yeB[G`Lra1OVlY~BPd xWsXN!u73Tdk DВBp>Cn%G~ɤ% ~#EPCXN7~śKIY8@szv:{bPh>ň3->U]˿ݽjW*;2PpQߤr >oٸʬEEJreL Zcɩ'T-WVqaY"AX2uwƊL C<.ҥqqT廏l-X[|z1y mv;ZrowUxgn[$bkuwC@>>zZWZL@J3Иsb:L2u$7BZ4*Щ>.$=q@쐨M:$V "} $&@W˜d?u:#V}2~iqԨ]XW8m,P )h\@6jRZp W ЂG5YpՊߢT!o凤t]|UI I⸢* &_ h*AjP W4` /Vp "@nT\CեxiC|!o'_$[Pv꤁4wѻʈʗ@F!(őxPzsF7яڭ-:\jchJG!#I{el i+amZ] Rzx qgA43j*b+{ duabCE9Az7pݗWG AX((+%wIr%Y nIV9I'2>\XŎu9H=CG/l6[#5hDh:5{򠟐M9Q+zH7H*%N`\g*@ ̰ia<eRPx=8K}tf@+%SG]Ñu0ݓc,(-(JAgcLGx6Q4W>$ rۥP\SD|h*~Ƨiwt1|cpR#eJ_ b@NJS כ(m>d#HˆrdPK{<ۈ[qtbPz]'Kׯ/< ْaС05[W'XcծJ^ bֿK8}0!tBQLD Tv%1;]Zf=SM )2g£і@Ҽ6 hҨ[Qa(!NՓg^3 H32@ŵhpO~~+""B7 ?{~XGpe 7{`~x'4 vցs_5$+hys4q`o0f&Ў?"@惡 x$| Őe~Knu@oe4"hP2J[ru7!g$ЉLsRi0ytj!;bQYb5KR1a#1) iR Fckq;E}iC es"m_v  spR96bOm A2l 504xv,)`aw΃]To9k0?. CF Svaא-!MC>EkQ.0=_.[ϱ۶ ~S(:P/LbU) >j6䫷kv4.ȗʅ!w;ʨ '[( 93!w/8g$zxzLh`''>#7#gzjuC;|5" uZ'F$7 Ė;{g4va{د=jٍ) WE;ʄikhd)߁'~k\Ql80;*bWElܢ3GPD;ݨYHQt{#_cWd/m=Ӗ܂+]˼ȑs yz4l22lrR@<%@cS8i;D1b@L&c׮[26 F.Pq2X`2G?25n$@(hq 0N6#R[?5Z)^_O i],c! YAR).E ؔ\I^>Gg/_ g#=39n}چr< 7V!j 4YQfF[~k [%C\[ t^IG t3*qD-+uPEY~ .ٌKrЀkײJVc9OġNf&#Nrl- >Io]~ r-K[qA _iu-q!W̡'V5 HA!fNC u/07 ШU}Q-Xʥf)T\ F.f廌YaC)VWT%Kja>v!1q ӆ󪣦Z:p,'疛8td~k!J|n$p8{@nHsnEeFywɮk?DN;wa_hFpx >r:8Y@:Lـ|e}Eq|Ą[ZrWBC\yd 1tKrm4h;TH$R$yqo9b獪@kގJ kfx> N$ QtzƖnx@I ,bکb &;cBM F\Si-hϨ3AE IҢ6]W0j&]dj"[9d"b_.#CF>~IT5菕#B?2=Z%">PιNf]= nwl`"'Q27.bbCN!)>:LO,&JVu&nq) :^'XUL])ЉZqVMo-:r?c6цoAހ"EW|lĝt?} #j%*Nnj\ VҮ#f JrteaL0҈Շ{҈or׼۵+V{J>/t&wv![E5.dQ`.r<a+l J`eaJ3pqT+*V(R6&i~ BG(hU& |iFEk?ģӠо~;HvL+az(ACZ+aIM8؊gNbD_=k| ɐ 4z/{?FkW1kO22}[och:i-Df\8[E7NG0>LM2kc2 kPuVx3Ф0:4)gۯCN=0B>́dQl>3Xe_qFfBݓdZ.赦"Y.62c^&\yn< 2`!>u30j-xVnk.Pŵ<* ZKp/+43pn0J3{ ZM v=kb#Yi ǻn0a1؝}o,4kvZPCl((kδBG؁0q=W=6%6D@.hֳdٌ8e$1 { 0 l͒p }M$n s?} uqx:o8|,E'opr 'nr ~{tT\j("AR N)ؤ}Y0%C@ϯ+~(>⤛c6֚8 sNjfjn5WQ@ 1F+ M/%3yW&C~_#ϊ KGE!xEurPgu6cL SЄG3YC;?]j r3.Eg@;B-&[$\C%nŕ阪6Wh(L8@Cޞ8ҥ)[1@_s_ (&p`؎zQ)3~elwS8?CLXu }af{K O5QDBMS9oR&)l5p C>WdZ}pY<J "n3EÄf"|Q!Ppk3Cwy@dvziqyq{G!.|ƗdJv|.\ _F;1jEQoaT;{Q&QF{]%c s-p|iھ걠+U:ؙs]ү e0;tRH_oJ!݊_G!ZNQG:Q4cTY֦Uj2|S4r] E&KDr@x3YFl~F*2 5ߝu0_9L ZQx m;aK̰+ēqo(mMͥԵ|ܹfWT tC-%kW/KR ΄U43b~n|ZgJP.ͱ fRXriLl+pfቄ|>cE6;;>:k+au cnKqNFgNX\{ )qb:Vb˧CAlЌ́f͌o%m53Kht\9Y決&| Ry?y|TޏS^ǃs|#,Y|">fnOatחO[VfUD[=X5~nXWuرmSIlpF@I,GMܵv.OP4]~o׷d>^8n{ڄ XKڀ>Ձۻg޳鷬#πq%&@` R)H66uUZtu}MCƗI꟣$/%+Jq@K ]@ar~)Gf,Nlܽ.E/J8mJ@ L#5ˠ'ȭ \h [-Ko1ܓi$S*Q3vϘ~H/w<  >y-2A1ZFƦ}ꜮS\@e| Hx]|9XL%3s&Bm'h m3Ykr Kkq<{D_\IM+IqW.eKَ؃Mel)*Vm ܊ |X< VXp`%g Ƹмn %<< ϫx:7<qR< O <~xP/o5]Űc0yd Nf6Z;C8Q&U F撱J=W@*}aaNU=N]HYBu9s0@88yܱm=%_R' %1FVqr8 q:cj?c';oE ,K>-VF'J`#K9!(+ ^u6׽8 x6*d-Z7X d-'; F/Y6ZcY^Y6Lfgoqr"QhSn ;FWJ %7:I3Qd/]_[ZIx* g$I6K ȵ>O3@5k9IEud"rlԀ\UkPZH<,TI-nu-zl404߄o$SA_SfwSIÃPmP_NQkcX3⹿!)6fpCzBb2zuʲdrǪ~n#37&JruZhá=U5a8SS;].P78[sSqAAc^ EH oMlP!&IjpL v+|2**|ggʭ䂧g<9>N;hh-+M4BLz/1mw 4z ;]x`C]} b'ǹ{/g`sUQ`MG/yp".U lFaIM ^i27] mo|;o |S_ mnm#bT$z6] ƛ}k,J9.{ÂzV~|KDv?T###")*f6Q`gn Eo&M=kjVe~ܸn^bn2oT6t*bLTf-ht]U:B̿AvLFlMxՌ:f6f1 9b2]ł1$/ۧm*F+}{9иubn3I~4L"ݦIlqdI#59TҞAH; #L$ BhP$7><ى;A$t~5P,> ^%VXs·|L1{Xqq&c9(79y=%T.'JoA[EC$<#{Fa|؀$bk*(^N+H:Y"<z%[MW8`Zم;ʣP67$*W߄] =)'욃D'-!aΔĪqQPTLFJυy;J0|:y % X]P>`В9,p\_-I=,pd,t 7iT]]krf!;n"wGOJrB;:-192_ݓcx3TΜt._ÎDngxcۣRTHX5׺5Rʳ-Un<;Mʳ7LWSq<{r"N =ͪU{@:Yӟxn<"&vcn@Rٔ==xK<<>a Eā|lÊbH[0jpT^o&Zn#>m@M'H/N:"Fq𬻗)I@5O5۔Ҍc'~PJ`$7K+ FbL#`CXS0G'Un~+}n2j6jx)PPG+ F +:h1+Y&G~}-WL?&?GJ?=򓅀g 4 eWI|*k!+M<vvU| {i|*7R/kD?*r+/5~:96ekEL;ם5"\XVhj(''̧V#^-H뤘ҙ 8?cA1RP!(yz6%o2 lt>ں8!)ƶ a6Ľ-gp 3-Xt%}D@6ywC j휶D Ib5V(iPo.(sQ ^epw/w=%i%PٻT;URa']'tݽKI9DT-ii d{޷>O_ `̻Y)$ϬiATlٔ@cbܧVdYgj|~*LmO꼹ux"3'KhgyV^̲eu{?`3,j=Xpf~c/w&V2 nn|][0 vng;lb&G^{eM>;@#KIl'  6 W;{$ m'U9}6t"SRsgx7Ƃ+?/͗ dzw%%p|>y{bx{D7E(`8ܣ_k#_ w)ǻ'~Px,='1Wo-}p=]0q'k-Ez\Im2+t؇uǬˏ`d}]V0@ vR ghݞFࣳg,??Z 1t rx/l<2U` wrpZ&9AS 1;v{AW!K0|?]N|W7)PP~>I\k8RPG!@S ;WҎvPEhIѭA*xS![\'^9oba?"r+58NYVz|7sIe++k;C|x (;QOdHd&=Bu׉^Uq09 Y<^ZNrRLi9?pO)JmIc0 $J0)kc$/{4"/5<<\C5)"|| ty Nu.<:WOd%rg-v'gυw:5cA.gGﶙI-A )KysJ[|?> Ihxs٥UAV%iH2f+i~')jxRܫ ԊptkRG-I|'_7HLJӦm&2v>]q wP| UHě(*U.;:I% @(4ZꞱR],B@K-?h-KMJvj:>Z:4U+Q*P*QW>^W]~_!z ^+H\θmY/b!M{)6|og"!^ ˡd2t@7^vJ08T"YZQG؎X0=DKK&JGˀ471pqSكT%"M\vLf<_?"ѻH1fw/a \{TTR+]gӊ{LI)L"VRj 20p3 r|\ˀYWbd]<>^kU9,,oZ"DzQfd FbCX :,mУ^]ϠrG: h8%p?Ë-3"A/I2RoC- ~>-0z&b$ Ͱ|̗NG߳ Wh1t 4]bk/~ϼ )QkfZBLb4 =茄t,b@3w⍗PHUe28VI.FKN4Vug0ҹܩt<;JV5Hr+C!~wSvf'Ft@+fD! =s! ^ A AA<%.dxF΢nVA=OkA߰(aEtU0Eձ;b/q>-ŕG|zHҲP7H nqtusq\#u#9Cf>q[4=/N VC]oI)uE;;2ѸGF Vw,*)zlK`خ9B|Nk2q\$Kj^4^c}C0a5qltmOES2RnxarFLjv{\Zw,`7|r\qӋT5m7ާsc98-8ٰʲ#u= ©I/H̺@s,d&[O6Id dKV#L4dAKqg6gϒQ+niG$9#Ӂ(R)΄)fmdϡmJw|$(tZ1[9;굾x3^_^*QD@,}f;qx@̓InDsxC%@&@j6j| `sVqkŢK^=gLuFSbU"@RJMM],ս>ʲ EwTJ` Xێ#5M]-ket;*tK $ SKhNj>Soϲ Xh<ޚ(L,[LTR[#a-+tK˓uw۾Bރz*)xDpv1eќzouaTqonꛗsI;kMl?:9RڏNl0:1܏,dgtw5: /N`DvAdxs$x~sg}\?D<x0QcV\l-n/37b"gɴC+GS ;lP*رe7%a{Q2v::n#X̖2K_6閼 2Ϩ/lZ9?Dgp}x5߱ZLkͬkb5n^\-fM/Q#@ =iw4Ԑqe̷R{̉>( }ftҴ׸J#t|c-{!"[GG/$SQ|+Χ/h>>c4r~&nDuۍ92w#`҇M Xz2^椷#)t <)1Nq ϛ8i1{?inT3t(tc?cm-o1k`F.ŋ}t:¬XxD{h}zI.#LD46砮8q/QeUf8n|X'DY/dr8=V x8Y(ܽh+Z7Uꕸl7x*fhnI:!E[4Aqp5ZB5qP(~a${mnA|y Ŧ%u*>~&CO9>͓LuҺ+P1j7LY'eĦ;)OkJX@n\hCjh[ }-rlcR(Gmk z>E=>||;>F2=*t4W_grrQHQbÂVm4Q1Xo5~*-"c<Gy,~Td7kq9 LG[-Yo$ Q`dTfHHQnpo͚ leLp[7^R8 pF ե/kxO7Q)`X tdQ2GEFHK Tw*P$Vs1J5ϒI,#"_ZdVv5oPy8ļěӼ mc0*ycWboC]O=#iO̢0jV+H05t!ҕ8t=Z# d ~wɱpG'=цZ1NVQQ]zѩ LBS}pڎG@օjXVpB"RCK xTյ8~fdr3BA#DD-6TmBI' I4E9P3yt2A{G*^JE+b jQw: ZkIKf쳟kZ{h͑4tM%P.?G&, 9uV61Ce'`1cp:nJgr_IY-u&2px=ܡ}^ 7"bԃ=`d-OnײE6\Ft!Z;^"ʣЙvÿ-a;ȟJmY։RXh΁c 6 Y|Prن,Df ᫁1@-F)Ɠ|92*\<ٯ5^eG/RV2\~D)"|bXc_2gQzpW:Ss2١6>P~->ԃmfj=|y `ֿ(ƏcI|ck(ES@;Ƚgvt.ZVņkaNs:ڏ%jvVzuc0ކԾ_yA^Y~ٵ!{SH"9 b4f |bk$CF[6XNBQ. Fڃ _BD;?1K*c#ìB =CiuW}'UY  ua\da oܞ5d --K1-2n(^c/zŐZ]BB/lJW9C|㤔t[ ҌPnwF1e>܉yLkWB|N¤WĆYg%4X.lܔ6l~iV~PK$k%aS1>dlX;WfE[Wk_[ a$ z!s2n'?j- fp'>ڒ/VJsE1 D"G'.RGs尲ɕ K+R-fc<8 ϓ6\s>QkUItj4->b$~ +H q]A(鹨3~?R,E+,LI@V_ -7Yjyt.<U/"_ SlAȕ=!9~XJ!/{'CXk pWFPrS&$&1(8?x>gSS6}Q1Ɍf3^kvSwT,CU+*,׷=$SBI"(VG!m{aW3 a+Qۨ[w3u+YoKiŠZg&[eut+8 P:K=?IWb8p@6v`Rp*Rv³f,'+hӛ@6=[-MOB~JZKQcZm[ I֩WVoyC]wFu&~u.0P4~<Qߐwt}CFG^`DYRM *Jv{<&ٜ|e;0p3z|x\}ܓ(ޏb`؜;=SZB?3i P},׈v$ ⫡ _[^QR&UJ^J-QhǞ;kK~p6-/E.š^T걽gl5~7|>;7{}mz0ĺw mxdm6m;ٔ)lE[evǯSǩXZ[Öpb:b'IJS7C/L7gZ8j`ڠ9x؋9h4VBUtΗw~B]@D9ڨN![1྿"JJ?,?gfGY+RHC+1ˣelP)5؀N}47zV; [ZXZ=?S$uV!X7~/}}iaGc OYgzQK eGkY_HԤ[BdYцq$뤔3*j&'<;sy #2y,kݓ%%$uRuWJ<j v Cl8e—T6/n 27Sd3!=%4W/*!W9PN:(z+ƒo Kv͂׍_T=+ӻ9:*&',?1Q$\T[G5aȌƐҟ/ޜR_dT{ cb udC C6"Xꥻo+Z<:=ɺV-+*„dB:>:~AYv|MF}ҪGe&MIC2Ѥo.R)ƃ4f|A]-1u;w{O”AȋY'1ۀ?Hz~`o)RoKغLߡH1&=f kٜV*/#s!=aN@8d+ yyy`v嵙’y;S(ףj jR8{ǽ  G_I 7*wJndrau$IKH::>Ő/o_'FeQ}Y7D; Xo?OL]B[%sAMh ^'=AeM@oY/ں k.wtv#cKvqh3WgQNmPf &Wr~/VH r /o"H9klސ 5e9~ɲ5syf1S ~nǁhbRX I;8p}ds1A\ㅺ}MO`:H娢jk- x3f^ů[̸il#5ORs==D zAc S?j`|bx]Z7ߣkӼo~xe ة+Rb>cLVL8eƊ2bbLCy="p[*zK~K[]D=  ]5У}}e,+.f,_a6IWf+v (& z;0'#O?й>;?)N`uF{FbLTYI#Rr?iz@5V#i!uGό"C\ّP y/ԥe͇e.{m4Żֳ6V2 Ւ A٥"5d(nv}[0ݒVNztM;s 4t.8d[`&g+8 2u$4$ZDRDD0, ;Ȉ$ufG V龳гg{G@VdY,͹]g28*L72Z AB#'gdͶshO`T޾$~%(4u@']{[HN߂4 &*F:O7;:xܱ#$PG8>c#lF9>fŽmz)؁F+uoG?M>y oATA&2ۻNLw++u%GP˾#(uE mkŌ H*_ od֠#"x%g(s> t:ʍs%H#,GV_+V7rYavŎti-P3SC/#̗fNupP,k0+QӢϐ1X|.4hERCVI,)yZiޏ&<G疶1yXvwaVVj(.mUrYpaJC+ގ$K:d\߻HFTDI[-5 VtZ?!(l{E(T3Z׻?` ؁dF&Fb8Њ?i^I<2ª#- Њs^OQsב 6#>ot|~4hM|n88]lrEz:~y1mSmCl 5'զb5{ 0@ۂx0u+bЕ}*jOi*Iv-נ꽾v 7Q軾4ۍR'Lm;kM U0kiGN!kݾDDM2 W ;O6\+Xe,)yzkZ< "2|bENSɷWx1A8ħ|9϶ K!9 KuX 1/ Uka+o"-o,SH{s@Qт((J+ָ+'7^_橀&ֆEA͘"eta߃#{0jb|+@ /f_akPtn&{P JŠqk DfV<i&pe(.Q)`v ;?tOBqJxj͍6م.ebˡ $qO'0:$~oAZ;;$_+."bDL;-2ۖӪd4 WKas#!qU G;wX-9|~v@ 8ԕ" 7gFRk`߽Ke]^₢X4rDՌݜ ckn~rA>"_P;oss Pyis6 Dm&糵 LCtʏ۾B};41FZE5_0c9 撜|6!xl7mAXA jul?B*(Wn2q9G~\-9kϜggue4,ԙΚ͜.c$3gϷ91V\lZ* r8{=#  "q|N9mЎb˸2`"@5,H0dtGw+ޖrqфZs:gf~`D ȳs]NH$*czB쮚!PG'_ykEuE-m 0??5PUhǡN :{ UIQz0^`x{h7N4=;V{am7uVǀ[dRyK=4$PJOlj3SXa-Gn,jz~t_t21d"hB$W_m!nбyB4hˆST+ht YSf<}KYmʗr%'&XXɓ.;ju?Su*̨"nЦSyΠαۄer˴i_&lXʿfP;.웲.3wsޔǜ|q[He$Q+&! I؆6<}T:,6k'9>g)&baMD(+g 7::RN4t`aΛ~2Oߏ}SWx{Hv!TI,h^݌euּ@t*ϨJwc3oxlfoΖK)u +a)Ӿr;J|\!شφL=nL:$t8N̙ccx] N;DplXTNՅl6rxQ(VЯʨnʾX FHp^gT5$?΅neWtUø=\Ȃ|cD~ *ԙ:ruN3JUqdYXچa"oH=\qn|<%ݍFxQثW+:/ ~uM-d_0Mn^H}t to:1*e1ƀ|F aɿa++ ywŎd]Ц16Xy 8gtK3ԹZ&T S [k.XhD@&ٱ<@6"d8?3M"2̛6aH$~s@Q4! CgِJls7Ä<gb5F'$t ^[؟ U=masr}krdy lSE #IOE{H3>:>0͛~j-k[zԆ9EH *j *_D UP߰t:¥e3]2V@Q` -BXJoLT}ToAGYw)o؂Kj .Ej#OsU6<+,3V1j W*R+].vYj7y]9~]vbvi*oЍ2a}$EreW\RJ@(^ځvnF{1D@6CkJ&4\/ 2`҈ƊTijd܍e¢H)0o~#r‚q7G[ҥy}VpyW+YWJG[sWTk m-aG@\bﻹ A=dU"R8&\-Ez*R^V i0?fJ)us2} '*(G[Cqr[6:A[PMh.oOQJ0 O>FOk'\HlbG+Y*hzppWӈN;abUܖJ f4Vd8?9$𰄺<qIq\F X8U J~߻zEO8BNcU((zx4]d d#(&[3k)˛xf!Gw_fd֠x[\4^d\un!!wv5ExQT}7nI3coZUC(ll繤H@x5XgNpt=N*z9G|.8Br_gZ_kK̘ؖYmզA T nitGnRIs5#飏dD3($9BLI[.矵\RY- r6!H/ZQYѡ?/W̐{GnMq)s'[b%cIO]|,߈?5({nԏ%9|{`-j4n1!}sa9폞 U?u\t]VtcPZؒ F R!淽iɄ܍[H~@@li =ZSU1Cv?mmb#$e ɑ>y'H67q8nYǔqvz<) ?qi )t5K+PF9`@HA)QW } >2n $oE@;"\Kyo!WZF,|w!]po6G/V=;݈)4Eಁ55_D_~lLG#w\+@΁%,8hyl%]IA݉XSpW]t<( vY(!2C9W?a54;k)TsΑO{!*> Wp8`v.wl&HKȜule{k-UTr7.!xGWج CZ\}Jу=y"!lj]G-4_A?J^`7Wodn2m>ԃ݀@HCъ?+QtJ8%=ib?gi?3}?&Ѕ8<#Z)hXnkQ?6\30sY@TV^J`p~l' 'D 'M(M|$YiZ4>g#_mɳ7#i=f8vֆCP­XY؆ ޠ2Ƅ""e1 Hc8[wzO4J#tǺKH9+ER4$(@[z(  W`+D] eP"/@vԂ ˩3{Cߣ3\2xzvlT\fEAÒ䱜٠W 'f ҅ tޠXLM(+YT7.O#ҁ 2IG.OTOYUV \ekEIEOq{&_HDۉBؿvkxsNEC c o^2^҃Y ւM`#^]Y}W/`џpg~5`P`ۑ ΟK9'OYw0{,tx?0Ly}'ҙYASpF+V1H c߁%k9b-+ _G UR18 `v:-~؄K(#@a4qu5,뎓',F ?zbHI{:0=5H" ՑDZ%eY͆8{},? (LT&蜰+lFMu>~[FRO,du_A_ !#\ P)$j xTD?,pCcK`R|̚|qTGH &\rѦcZ*"aq:e~.¼6rPPݔQ S❕ gMiӔ#o-0VH( F|c}7Z `;]Xr9A;ZP[wS 6ط_"'jKJ FYrPWY3 P..̵@`Y1EU*IPex輤4M$0tN+bp#iYw|sWY2ANV)O4ئ;cF:#l]6[ՆIUU~9v22 ˩*4NYM+QfIwI\SmV8i&z8rAp:M(_T%JPpjְ 02jnGT 5iXG#r@^=H$v4ğXBdڪAQ*G7Gx=}OJVzx`Fx-d^_'/"="EY*NU|:!E޲.ya2EGc $vZ/b=_F5v6_.]'S.[=B͎]"&by=X$S8"-h@bHx/༅eŎ=a8pɨh]_/(-+tHIgGG2HXGF)݋aw*Q8tt>L.u8>ۈ {m`q3`2 5vT2تA&뤙ٓbZ:4 ..HnQ6YBć2.|_Ԝ?'U? W#f@3Ts^g | c&T Xs˱@ TR +G* | dW`XǨ,ΫU@Sx74ȧ.ǭOQEe`-/EW?U7ZUn)s:]EV$1c;L쇵h񵩷>[lKCUZ.ʘZOmv*rtBn;\(TOlgtQh;vau_!tXWۻc ct /_ \d.bllQ;N 44;oX֎]8_>Lȃm~q.0* c7;$8OTp)_RQ̞gP?-w E/<V@]2k5H5~W[>5:el6쐯}n &!U4kU//c;֡irOLA& gWmdE|dmQd#>eߙ ^'`z ެP<$A^f*J膖'ɪx3* }#>d#"3%;]wH\WR6;׮N{{^fɐ$ jQ4T3ٜka_t"{"頜$s&%4$t_%jfq W*F_RtQٞ7PYKbõ:UếX/@/ŋ̉!_|8NZgwy7/T4=kk=d>2pVyn|tVgљ 'D g'a)pN~x1IN[e jкMRPӧZx70AiZL4:쓅wɲzA'yE\gYvYYrO"G_0 !ۄ, !jj  Š$'hKB\/&Z&Lh=tYDJ|՗! kP# K}meka;6v {6ݔxYj!{a֠4`+LO6r)/^b肤9Y9 ,#8ɝHl8"rhqzgGBhsΝ;'zuh =b,NC-svY4 IS^i݇ks! }A=X^55BŖBH*'ֶe,/{:η,v"PZ \ef,rWPL,ײ'EMG!;T4+Hn..dh|Ik>w%&=ej|2DI,m)Z&Y 3M 7n&e@2y.N=X ?Hl^;QWH1,8%Nҙ'eH,Kp?mpZvd]y&H떰eä'I'4Yz'CQPMG\8m]ܵCPfG¼NȬx/mo|hXmz~Bˉd)F:Mk2'rXl8 Їlփr\,dX^H-j.u%ATqFROǝ $šݑI>Y`༠܅\uwg IgDew#*n28j{vKAYM}c1ӻvУ*[VzЫe`_ML Rvwgn&W1)eF|:x% 2Q^pI}hA8Q{nDA(4|[E? W:u5r'?+S kMkyV0e΀3SzA^ܡoc !K]w%}Ͳ _nѣEw^Q^6TOH@k^:X߆6} Y=[`E"},ȷ;3OV`Jd1/&wn QsO syhK:܉gx.jdL&vEXq- (CցNv:e[LMv,vMOǴlJ7/pXExs& )3`[h=}g!*$< ]dBs{G+}x'l[|vA.Q:`[ riqk?w [0kf[tBCF_V7NgG IQ/7YN&OŦjWeZGi줄1͜U7,f#\Gڧf\?3aЊ_)ms/m ' <-'o ߒoˬ-{؊{_"k p\M|랐r ^oayD;W&}U@G2x<,#%Ki)"J(BbDŗ+57 K ^4az5qMM`uR MPGL(A?`L1T7J֕$zҀ+2'e0{(xJ6-Hy!Q7"O6ZNkZ?2IUG&%/ϒȴnZ7@j TX>$=2-mxjI5Ч?ʩ^TMCg/,)ݘ{I.l|@EsFI\|,r9S=Fz oy豤O)y= dtm`!'<.B3&hҡM&g/0סé V -d9dBh[{J91L(fuU+жgpn5TzwI; RGok!9~:I51]pg?B7K17sEPp=ƒFM\HQ|׾ wEU`gTP#B kn_,A + +bP 9F_ * WeB,*@eY'TR$BWs]@WRYh[HYOs,kʼnΜ^@!_pc s%=X/: Wx*? wdХS. rω[ ,V$j{C*I\}Ot~R[0_$_̿Q`FL_ MTU;5Q3`

Akbv1Ա^ގ&DV/;'Y{;8aLgԃ.5ROhi FzQ nyvm=7$j5\o_{:?VR;mDv7n9c̤A ҦЇQ0vH;tstBuP#6B}9W )By58 s"ӺYk*nuOϘc\tD#CRm&/ "^ȪkݘNW'ء;PaL? 7tx"Si.3EMќN]۫w`KuZ$ [B#ʙ"̈́-۵P"?r_J_gQAtulh# X'ȡ>?HMSPx%krt7}kX9*%T=ڴ[zm4z΁Y*G#%wl$T*l74d.,d $Qg~0jFw쟟6͜W7EGZـsr'd pk]Im SymAЗ Cx=0Eӈn4~5"H$;<+n3pǚ9Jv/>y 1Q (hb|p,_GlhWޫħ[$ jTh1niv ;:/'8ZM2H) lB6$mY+ڣ*-r3)}MJ4!9jyb==<>|2$TJ ^<wN8tmx;zppSQ=8_f4ɫjL 7_G=i@AפR}15yb =~1S6R~U/M4{}xE4W$F0<ZG#hdxܕ؀`אF5#\r7x>5Z<_Z{+)~VkѶTgw^5ab}C5W"$Էar<':ռZhxNmioL܊j~zۋ NT^N?<^_ }32[B)tn¬pI[eQƍ8W)H_V$JFwp5K"&\L57-d%dC'uss[Lq?֢h^/,kh7^ؑP_ގnԕ[heoȀbj^h%ZI'7ā'эWkS+f߆h.*xi2̏}.AK, ޒz ^VڅԟKs. w#Pw K|75{YVoBx 'pHofmnե(Tҳ-i`*u"LI>LjpZ=?H+֮Rh.YtrYa*BjAҊ+qaAGzyB/c$l=kQ LhIQπ Bsl., +RR^(ĥFk;Ew.\mZ!G߆=0 -Aͳ:G6vo%mK"5ܖvߌ](PٍTB*/n20"U/÷Rs:z.^Kiy][Q٩P`ayCB| Ub/^T 'ȣɷû؂K"QcRlу,$9ӍfgQ9Qr\J"9N`TN ;/J(χƧX!zw:>(C:bwgB \A40k8i/TȈa_:1-v([_2=-(mZ꫇[m*Vjwه ΃<=~n"\-HGWubuDz؜~9!;o6D|x~2g ff{s&;8Y;vYYuDڳei3]ЏU*T!>,dGH¯.,A!m X1-{o,N >#zXeg(8v ڀ5b(jcV)3H!RGCo"Rp7"S]~r&L:GU} 8o,D`Rm5BhfU(*zpTSn,r=O@07V;V|F J.DU%L KB(w&,̪eV3oZ$˻I6%T5׎w#סݱ%x Ehͥvm%mfNkQXq-tƮh-`T PV7ݍg$lnpN d"yf3OFݍG0:\zD8:]F:GsnOw_IezT[E{h_G(J?Kz iwG]GK}zDAWj}z0 /<'{?&%qRFW*9uK8;D{-n99dTSIOp>Ic)++cS):/!;F]V. ´puQJ;W* ="vNCKͽ{|T0<3Irt(DE5 3 c2Dө LN0ֶjk-*V $%\-ڝgPcI\ydg_^{׾\ME3rilC x=]^ Nݗ"3B5 ]_RwTJE6DnRwsX"h~-Vî*x:2е1AEn6߽b }w@^zc%S;Yj1}x/-Yr\bo7Z 3W K-EN~j1]ǧaRw;E݈{8 1F`hXCZ `{oB?u'J`3q vb1HJHoB 6*;mUqK*Z6ZbFOFHn?Xeh$Kɋ;2t9*H]1xLY17glmV[vҢoږM}B~!!QhHȭN$`/GG}]@BuhܴDu!f"Q?xZ \4un(j\Gy*?I \ՠ /es] q;CRÇ\'l \\WWf/v:O+k6{M^4{NmQw6RR[zQiV^/tSDĤSxd*e!OB fyقT\eHg-%%n^7^d*Lhpa7VӺMɽAPݫ\0h Ubwn2*C}?xHCtAT1CrGo2LK:w(bڙ]Gjq8z$=tE-a%춣<Z{h$0F{ݙŮowUɕ/`BQl*L~m)򜻡U/찣zY& /swmE({ 0ɚ*4 Աם{o} M!~@OPxFZ작4g!>ޫ&uTC4 UP=❙f [eGKoQKY(g&F5z7_,sE"zR!뷇@cJ@n S'= oW=֢*lSȼ"n*w, VQ@[`=v.yPr&L :/;OVarKg P o#5HX"Gk Դ{^S?*cьmz$CJ(F%hؽi;I,ODP}{d&4 v{axZT+$M_ ڦHG89]H3s{pv.Tʐzx?J 3ylwt*y 0sVCFUfB2dR~; *zi>-BN ՝CKs!@bU8`/Ga!ڞm 5d,p4oGY^"xut.^kW_gG$O V |X*GJI 2`6ØScӄRE{s(1fK*Ћ `e~`0wIM!Y{S004GаȂԤO7Z t\lr- Y-ݐ@yt+\KnȵD-PX٦M~I=ݨ'顴@ i8#p9 5]=[`-.qEÚ:0eY6V 8}ˌHp*ԃ *wGH7 /stX'yٲTp_yUA4uu=!mKT#ihN}hEynS$ϚDyeی惭նmM,M[ө" Io:usA擸TN( ? {2*s{8H^MvЩ ߽8L?vV3j TDU+,'q뫷@nwk΍g>iװ5W&`(0 mJEf{qPi%ˀ0Go,PYH۟T7z_ol* {1]ފS@@f ",Z}[B`!gvq^TDC6mMJH3 A׊M'~fZpڔ?XoA5cﵙMkyw5e7/&H|4CI io?EmN5G$/&4Ŗ.Gq?J0!XIlo9ߩ~Jރ !X*WŖ^cg+lf< [c_cB>q`H= Z=rRʫd9VF%YOP~?d BQe%3[Vkʽ5DzCfo eSۊE_o7a1&1;aֱ?XdN<؄@ /1I!ڢkRxkdE(3($XeWqC%jt . ^RE|titc "3 Jmn=u}%h{mO` J:)h` ?=-ؕ]LohGjNYnlL#0I=]<Π9rV%nhXTDzZKD]jQ+~!8ol ^vEZ"8wE.R e^vA[#+e7bLJ P^ol+WX blംs|O5e*&gTLڨ\V GaJRTЎ d~p:h4솾lЭ|+%]eVV,@cے/9@fB$3.^O_:_ )5K/؍2ɪ?C% IH(eDeH^O2cӶDChHy9ݒF/ i Dfx] :wR1ih>Y~x!Ղ)Lj\o)*,MOXqjKԪ%kúKٽ$߃b18yGLYk-t֓]I4'oiEZ$6`Dhp &e>汻I?xMP5GF ate@cuC;&,!_Ũ1{*.>fE[j; L@MQ׏׵hb]8X]ukz'օgX[H_s|H YѢh.zZ A{H(tPIRYH1V]OM6awlR$K^Wpؗq/5s___FU/[srԙ0E~EؠK/3 ŅxSZ9_4噊Epy:NzIG[mR5ΦD]t6Q`}pV-X9R8jT6KRRa`F"dOF9aGAڳüo3™RB-4mûg-!rۡ=Ԟ4XvH_JrӬ1~e{;Nf*#:2\"wH ^Rn4> $JEA i4,5|@U{ҾLb մSi,m+ Z1TW&Hœ;mĞ/XcTSUa#A]9iD,ĐQk'L qCًL7<hH%4p>U10N~nRQ>lgʙԳ-CEhߏ|3QO!I %Mh[>3:QCg;*PLV&3Q.\ΐH:р[DbĬ"&dz”38?Ic l:UUoJ!J,s);`ș)b1x4!# /lECǞkYVCb({ yߌ$)-zH8o|]pX0BQM=I.]6kWq& H OSOO¬~7GdVa9dblFRˤQX2b0C=o;w5͚рSbKlJ /?sl QZ@܇RS z2ktvZ"&MByb_Е!k-KdH ًCZv>MbfX Xh 8qځIt-$7R6; hx>p790Dң%Cdt#neяu)k;S'`׽:+ˁb :3+/.`zb-9.W߃f 5rR_y:AoւB7f)E6ie3QeC^ ([)y/V]wQ5Ÿ4N Krw=[줽rA"TZeV-j V4 YJ]A^tm!3XI↯Vu9sb Z?ŝd*"9.`%LY ,,)k%GQ?ٔl/߃ߩչkmp:-b*َlXcf2a=d*EhZk"(!yG`ZV>֪^[m˾P&^G&_ɰ,nLULuZJ"ň*klhSJ<{7&h>^v#H;360C CuÍ%!͝& wq1_##e)糲G*'KH&%8fC4?`6Ԧ-A^`g{HՋ:j,GYngD6^n\ΫǗ8k5Hw)rL.h UY8 hѕ ,j.q]5شUA_A Jm-0CiP LQh!kpviܹL2-͵{ %rT"M'B4EOiX 0Af ⏠#*!*r8&y$%uh#ԙH{TN]44C(IߺxCk4<#VzJ2zCSWTޫb½5Rv=@*@DH+Gқw/pv|//w]g߱yg萿pÌmE\# G$M L!< 7qؓ'4ew:wS~Yמg?w Y_8B 17 x_n2TuUU'j@ ű^Rmb1ЬMT^Fl$Җ,;w:lR|ikLWM (jH֊n2-ot Ijp?)Y^T㈈u`#E7XSZ#?as An)#&^VɀwrnXӮvHw*bp*fFۭ^F1Yޜ+ݴ|%l$%KY)\j2f(jsSA,l|CyaP`/ hFʹUd0@AsP`kbՃen,KPs#3u~5XV+KgD{!y,Bǫ\4{C8yج,5Ve~Ab2Ҳ6E+Y@H^6uO9 aja.enߙZ+(]sR!Z Bf9VV~>,IJR;`Dj4,v[~OTW6..$]B뫷g۾MRTVT€T0l6zsѰ"t }VoWǧ|>QWV3[vEF`du,V}u/vgvfqH.MYlrFM 9itj^oFA>Y6c1}4i 7暉g۳Fa܃1TS@ k,Htc!Lv ;eJsȈJ(ʢ䢿4 ?99_sfOsCy[0A)4 lFTR?P{>u\Ņ/15|lknu Gꔒi7dRTJ6(% J+.qykm-IkZK0]=&kYC^s }-Hч5A!f9%ht/TFW[; Yq*NTls Ŧ661m^6p F$ѡm8jjԴ)&T%#aKG?AcA 2^}/Fޛ"tǪbA:A(E;XqQ' ;n9D+ss t r^<v*#.FneP(m [}-"#jZ /՞~yu@^wY>}@: ?ogB%?={yNR e }xfU9M{W6chQAGCG@@,HxDK ݮgE+G] [‡v12ϡcrgBwC B PB|/<&?_Dc>X>v)C BkG85;kɗwJ?oe6<wűkvɴUDkHygžk .__elu_nw\!ǯss!h߫|{C U%=fqc=Dx tiP ʡ.37xRnnpBBW2ocVY\sn d jy Dn#w Vv0C^=(<Ϻ-{-#nY$QGc5sK'+jNگrmQ^selX?|)}P*}$ǧΧeIlRLWsA~o|]wޗo7}(cVR+GEDOJۍcu4aQN;-O"*o:򾉵˴o`M=~ƛoJѣVp0Zב/_+ H;iπS~Z_ݙ J9?R!(bwJ% Vݸ\4IW9KLmшɐA(%?j;H bQ4FRh5Z` ]^c* m )@.I&jm1ŊsBR)E_0>ۧU=sǃY>ҩ[QhtO_uI fCsbq\1•Swiyu /bIOhQJ 0:Jv'!$B|]6G Sg0 ?R6C!BCkIS&̈́^C&L:TwAKE%y%J5%m9.SC<9|(K> M(>#`O+g[Kf9SJUycY#G\ B[igwqnKD N81g &%Ψ@k_x*֠гo =F%uZ<2}. u.ftiD16uXF{fhs ] PbYF`پFGJ˩K#`k%h`y!8}f(kDe1;N/zSJQEDK.'MBUƝC*u/bcC4Z^Tb!4^RKI7`1Ag0\rA.Apb?{A*L"nMP^_ځiuE麳n!+xRY'BBۏŖ:Ju_4Wt^^өH!z1-bzq*l7߃X+HM,q{Tv^x z\]"-4j"-Y ⹡[< 6I ?USЫ6e7 rw"k|AS+h0K%Ut]MG&v ("~ܼUi#]Jx&3t-.^dӄ'{qkb NڅkerM3X)q֩&^,.l=d{pȔGDcy#>vׅygyĻ{yVw9z &cOy]xz( eRL^ 1!p%8CE׏i, `N1n|l'98.u;rQ7N-ųjZA)AǷg ׄCJ5UW=/;KL{w&_5[^g"T:v&&7w訮B2ܜy? ة<^y! fIĊw]k][",FLfz4LCt78/ :ػmƸpG2}$8#A` Q xVUU~vڃF[!w9\e஧vux{_6_M Eԝ@r!XY3'g=@&'tx+@Wy :{*3Ces6pd,hں ,H-rњǼddV^VvFށZѷ  J,E#L!něhsb0~~suP[ G5ddQ7x[;3e+#rG8 0ygc mROR&LVgt;P3qIpNr 9 C;u H)ִVWȐ"QGE4D?MS\4$ƥveY?%7#:Wnlx2]'Q%xc~SBókN3ܯj߮6ԄxH㯀| UuI2 O7?v?YO#d[l ~?FiF؊&&bJ4_K&q%ф1P{:>JH;&]^(7w?{wVzO:}Ů}nt@>xH/G8bF{^ r$*2H@^bo|XozoXy ^xsDӨ<1G~jon#0?qO˽̄%y n7S!(ʠ?&/"1HYdԦUjH&U$ѰHJGjP՝ `44X i|@e’rY~o5y[k ɔ_NϩD( M ҙck Z+:k! Нrw,.; x}Q* _k#% /6?/h԰8 D*d3Y(*$U2!ZlA \SŃje_ ,&m0D?<c|GB>``, \Vu On߾F.zԉ0[4za6ɛKjf9i3FY7H _g{qlk nK&tClh^RHR3U(%6ʑQwyG.Q.zH&0zٴL4B5r*>uyhr> 榣{]Fݻ gʝ.r R^؆خDȸSBJfDJZ3.#Cl (S3P.^7X.C;wC{{PB (E.YѢ=d0 #).yVR6韂j^TBO)ϱK^v"d2zhDZ 2SgQaE4[ъ#CFXb@9JVbg8!PX6@hu;Ĭ~-x lӣa$cS9Y6[vx79+-J$"b[g];h>_/eD Hzqcs!36|b1O1QTU6 l|N~|M 6{ w>8FYঞO]H= 4O @ Upe'@jՊۜrvg z(ްL VțyQ^Nϼ ֭#^yDoG(9[ _=zKx~y{طa߁Kj薓OMXt*hJ"5nF%lϓ\kmKe>ǣ~s ӏAG^3~&'DA*]G '#$nc?L?ti' &{Бkx((p. wPsǕSZ0\kf0eǧH.ܠB}Cv@=3DŐ.HGMT3Ս#CLQ_=ШÝX6O@:G;ʦ1\(#&'؄>/55x&)C J S4&JP0GVui oqmx04۞;lV8I%tzmj6"YK1fyR'uSԎ>e,ldŔ 9<:=.~P-MsaGѷJj.xރMF7zF|-"lm&9VI@dЊ{ q|ïibHNs3Ŗ=iTETrQ`Z<; ɺJdA7$_@.\+ۻuߪ3zwh H;^8,``zTx : |~72꼫 eOO6?"Y e;i uxs鈗w-zbc?e>B{~.^LP*0Nρ|‡/>NI][B7 9O5Ŋ]ϓY ë72KCl*$|wg1?9H;NG؃aT(?Oˢ`B ^ D?E{OD 3r(YXEڊ ''6ӴUՎwrяQH2yf7>=n׻䵏KL2G` l_^?//wRn}-lX&ao|݃舘x yXq %rnu{1v>q+,"j)r ͥKvct۷L#vb>gJu"rPJ2i.z&J*0b\|HV.& r)=|;#R#av"P/aÔ+MkK{\%ņP;ktG)7b#am0f`&S(?gX bo0V7]*g~Т WSA> Ő?Wr0oѴ&A=чgfM{+3m)^O&nJ*8ncUG q3wx7|Fzx]Z*JV 7J~*2J-u`B;;x泛=O6{:).Ylq231Έ,e#I>~$mbH^zۚ9 \{HC`3{g9'CMaRÛ)۰9y2XλY0dJi"LdH oCW'aGH֒n-g#a`Bf{`tŞ!e0T\x Bӎdi+n M ^Q['?Q9kMv܉aXO%\=Onqcڵclsſeoq2ߗ Yh/ m+>{Vtm}.srSK{PH䃖,bwjp-jpY;M`KYuG-|/XV_y'Ӌ1obP,[6#)uЏj[Gф͎Ef:DL]s*<#(Bş΅fڄ Bls^!:AIS=J12p`-h7 ڥPIxHP~[pBh64d&ETⷒP-Q9Uي?OmŶW2o ݦ]A4WY^̫YF<<[F xѷÈ/ojinsW5uEtSVޮeisY)Gh ^/ "Ls@>W]?G7mэs 08%._I1<.e"UAH_xtR|'Gߧat+UQ y!oqY2 @pmߪ҂$:,S0isSUw={e!UR*sCKµ]5Zvyurg! /#;DZ^R8Q-dP0 GMqr@XY(8\#k?@Ch E±jW cHd/ @GC*DUx<&| wBZ#%q5xFr&:CKUQ{< Dg8"P[1#&6Q16 ׻b=غ J R w+5R#2 %}mPK@` ڥ[F쒀IO[[vS=捯I& MBľlDŽV@AfEO (*YB;²Of!TKIJ7jٸN60H!lJH @LL)0FOF~ǚM^ EE!q_P_#-dc ,Exy )>ŖYZw!˞ Ъ`u 9J Z#}ԅ#H.) JiMJM”8f_}- x(xj]#)dF2*PXˋQ;+ȵ2}~bb*`nRh!e,AE*Ki+qS@K%n/ $vW y`gJ6s 9Z}ڍ:]dieR PFr'ר W%)Twn s~%`VmW@%kѫ\!őa Cr;F;?ka8jlٱ{ 9y37dhsBR+gG7bޑMuy:蓢 (ZDqErK3tFaC|VY`A%!^sNٹXciNy]d˦^?+!p٨ƥk7Aܹ$'NCK} xUpWWMF3LtaFb&4!/! E AMb1kQ:;83 >FA :3$BΩ$ ?~Uu{9Ga AetV+>r\ O: V2J5[YjYKcA= g Rzc-ȷU8j j5j=K_N+Q#C<ђ`I0w,7s^E_x5fcFrAx9zʳEYh"_-?/X -;,Rpܽ^6g.jMw1O mc!܏"VСVJjyXTJ3"yWez\ cT/m=AI1p2ՋP 7څ e,(%*=X~=Ӈf nOoJ,ٚ_~ q38l||xs/;gh}]?Bpvh,hZҋQ,I^]coSEU0<<$_˥c2~A٘[S\KN'ăI+ IGJ bo_?' R+P&7 QJ'|{}z]Ѿ +^ܩL0֘`(|^IK#"Q3aNjzou80FIRh\b{zv1 : @dёKgY հhjȭJ-fо.i֭ƩCӋt˗ ӊK$wLP )SDc}O?9EQ.!@dꄫ:B#(f/(IP`Gs`zG^ryVvī#(HWbr\0Ha(A<}Vo[]o$wY&;Hvx0AXS K xfy2kJ 2^B`TԿbn" `TN{SͽP :jsMf+R;k~8*9x&3]Ms i`t?dڲ?G^z~k%c󞮰FkA`#vc!j$-$ٗ8R Ā#`41lw~gMj{(L$[ϚQ[e nЫH<2m_6LTԻ+q>JX͍(8/pFw8_1u #5O0cn{Edl@ ?%Gd2+LI5 -[7':u,`ti:;ѤC2r ܩ!/.Ua)8u'n9,>'O*'gy4ěVYyT?50ZPigc.Vl `n/Dg㤖0ޱ-jJk[O9A޻RˏP߂ݦJ?:H _{$Ν^%϶AZT[ u8(ߴv'<%qzߗhH wh$I8xE"w2k`A`oҨ3l> v[Ыd"z45p#}?.d3G_@S ˡ5 Ż?2L6ڡ+Z9Jc-ъe;%-[>fX=Hc݄yHe;?}$0&$ VO|[hG00&` _< &FFboM|7"Mxk?S$UcB k!ʌ-l͓xf7xx9HbpNc%ke%b `X=lg@izjx k,"#=xes -F[-;\^pիot&MƔ~,ϙ 1 TI'D> Hjo%)5.:^8^q]bT3ؤRma)X1W(`'E kbK]Qez7ZRS0ǃ u3[,5lx {'t@M@Qv+Р/Ty~@ ]Yĕ!z sQ ȼt sҫ0ľ+"HU ߎfTml y/rQF_fB5 Cjcnp"q&~%6g2hY-2=ϱ2Qb|FKOH#T+m>+2}\u8)O@gVMh>7C aTs3lاJ\4LEpp89 gb*(ZhHۖY8g=ä' _()'bZʦ++;Mq8 lj̝a2! 5`̛^߂qqdop8 'g޶-!2Ceؐ(>F-h)evB2c3bShRsnү*XIrf>0` v^nq'M ™;Ҝ5YF/ge:Բk kvA^[ҼpgBQTw ! 9 m'Y#V\ >h aK|V|$[(7@t"{ϭ n` ⛊G]X&t-@>^k8VeT^=2O wx:Ч0_._ReGh Pw"JZ u7K-H 0DsaEJϨ~t9W;!{5ǔsdqK72q¼گV[:R^XZ^:is,~(7dO'Us2hYaX M@M LKX1+ThE6]Ku:k|߈ /5%:߿j]D+:᢭0eUFTm]v;[Wg\c6} k*F~u6oX)]F5mrjQhBjMW O+v^],Y(Bitt@ ybļ~EG)}^`ajɹ;ڏ죢V5{b*4s*~RalaI% ld륵$!bd J~j髹[ /u:0w5o-kbH&N_ï ~SW_:;(W%Ni0>2fw;`X u^o$cq4i^ GI v; 86 )KO 3èZV4+`lU>^ؘ%j[#{^ Ɗ!`QTņJau8D{0#&h0 䍍 F f(݊; ú3l/Sj/ɠ܏foL8$2\MR$OCT]jz[L 2.+X@]j1W*_H-,)7WԐ4^ױ9HMX_{0JDE ōV YŷRI U\υG"3+ڼh 4 bu#Vd}F](@5IUSk3֠0+hVl èc8{*7NSLǥ  -oNmp ؐdL*!!)C0eg.9Os="VѴa] &-dhF=iCE ,M$Y"q'SY̝9yȳEK5ZTazgyz3YǨ6OO{ <PIGZ8^iϼ%2c̻X5ޛee U˱v,/4a>l$Ǧhi9Zc75W_G3V#Q9`MUWbk2bkVlGdeR{A&wśXeRU]c,?+t)Պ^R!@ &Zlť q#l,tt+3z0fDK|r!CݐI#Y'&ꫯ2ۃX;b@X(nY*|8J|m'svs] ,ma}]VBEls@ȿX7Q̺f, f Ҝ'נd:3WTvQn؊8_d`lc񅑓8>q}@%!:7 \or|))c6$p ԏ'IЋdptwY-o9 7qL udpMǹ֢$<E-4@mEI䖏|QCcmEzgyǯ[Ɉ)z `Iz$YMv0.CǛ//'^nλ62T!6oC)&*0od(3`E^75xR *X"M m/DÃ듞(]+:_{3'ޏ"K? KMxŚ2c^#Kݱz=0 tYAa~Qv~j5(4vB旱tol0w]$ v&`TD 5C,xt!.GJ Ղp1/w(^a\FyL4@/thƑrNC]#\tv() r!Į bu}Yeh0,s2s.OX)";,XQ/GĜeysm-L`;ZYWʹ󛇭՟sOr^[J}yF(JVd un楇KJcV:xHAi>QiԠYo> XL>d{/fYYC|(UQ*j:~tZ9H(8xw}.ځq.ml" G`ʮA>a=q-^#d#F]yld#Ϡ@5$R9yXWNVbk|{k~Jkjg6Mk-{vwJSf2mBW{)CLɒaT8loߴDCdF{Fm)Z`^d X.tP U>K'^i_/P^)|A:(=Ec_${9.gu}Bei$ !磈|Okrk1Zlm-)r /: .,w Z ǭ #m nkku ud٘Zsz/RޕOjUz-Djjc8[N_>q cQ. >h+5 i37IO6[_4 ~. 6ka=|^{1e<(N*4>ᛦ[xx9gr:+fma,j5&c*[PEJ:%-0߁(O$uflMj.mjXݎv9|QXND 9{Ċd)?DEToECQaT Pl*'12BwXy ׾=:$έLZ^8%k2͓Zвg “Y5nN~/q-??-rivÛ=Ak%11D^;PkÜN}ˢܞVC#72|v f[[)3)私#\׀?b1Y.]Pye} ?u1n۩w]]R{Y Fm/|YW*BTAő\\ìl{|ku /w\NHkfĚg x |cN։t.,4iJ=qD_i-4pY v x'o9x;x^\yv b\܋ʘGPL| `>A<6휹4&YB ҺT\P3J}܋p1 3Tn€}4G7ko5ƞQ!$+F)ԏbS"L6جFHFSCViKU݄]ΐK3KVomb%SmoJf+$T3؁`mw n6"*;iPk#yUxLs 7\m4fK̈́obae>$1(GhwRz*+ʺ|n@гX>R ̬" b(*4CҌ0z`$k?Ih/{og[{yB0*:2f?A+.boo.0 %.mkn 3"ŷawҳ>)Lo< n>p/?q1 EHx$D浶 `-}z-iq /b;yҀ7-iiyE<ﰆPx4|I2O*KP=v \}wgڐj^fT]cԽpȯP kDE"svY9F;ũ Plg2]+OcgZ.L3!YE6TՕOmc' sIH.MkG8†*^x^hٹoq2:b-Y;` Y.J7|IBQ+` FZ*l[Z8ڰFCKdul~֫ l=k b>5¥s`ZIi$DJ#Ͽ!l`%l;08]$\G|'.C-LeB{]e` r]xŬ:L>hhZ L7x6vݯpp沚s&n W$R^-qVM'HI+lk~S-}HR պ>ɰ xmvd*-\6`3!Mm)-> fp1{2oh 3i+ l ȵpq[lT?PG(ŊXNцXh8bA #6:әv3F`¨)~Ñl UdO;jeMBH01T]p33XiJ3rFxIn܂OU(̐DZ!uI@$&Jw(YyX]÷v.+pFMtyD2{Zq̒Һ<"돮V+Yq8M_iBE+6M{YЊ:q'`$ɕdA+yaT)^=?񨁹R ԫH*X@`lP/RoFuwxg'B&Cԇ3tI= .мr6A| SK+rbnvgUy`(֫/HCIGFٳXegc Aڕ[p!Q)K4F|بL:#9:2n1 1uC!M}+H-, 楸s3rJ: 2N o5Y3Оa~eqf.Nhp|[o#ɒoWƩ5tSQ)]䑍ZRRp.t`NJﯞ\h}ױ3SufcVF& ;qe1O꿊 3͠[IXs6<1r@&N2"x7NJY`\'HA:nr`B3F'ib!sיuVFB,@dDY%&>Mer Ƴ9a*D*Ky; :-+" ~_(_byBäRWb)_-KY\-Y:ԔRՒ,JT#faCDFVB(ZZ TQ"$._ ŔMMU''pb/ှҐ#O ";uK"_$$}kWC4mgLӃ&<':jP^tXM90&\hVo~O[Y]Kݬl{IT|;C?i~%zDbBEQoiz.s"6|o-JmF(\E4!boUC&뒳\6ģblJJ*Gk0' ϗ,R MyM1j3IE]ԁxu !]^Ta%u<1;Mndz˨;'I1ZfӌkņzRwi˄NQ!Jbm>Pp4&>4˦ y|3HK/[+XĊz4VQQUR{vz|0,;ʁcy=v|WNV #uL@>ro"H @3-Ж!ÿߡ༦(,Z{̊bA}ȓbWœ}D:WPQk.cj{yFٵfdH{A3 XBSDWEU%Ss?a2-;{˾`of` L ?Y6"?ljH() obyd/H% 4 PӊδH.o3Lt,,g.aYOCo, %G TJWz A~`%ʩ+a~ҦcZd PRe˖-bCZKhB%'iS}qL)bk9ExM ScC E_O~^[M(:&0ÔlLAdf9{Pvq (J{X{^ĞFnlZ?Kedi/j)*;B3Xb U HvHE&kvc#DX> X9A٫5beYd"kVl攳ܹO;||kĶJ9fS]4vySП y#dr({?z"+#mvawrigL ]UK`[ιpYug!%\V_.MIT=٫^h~6Q0Q!yMRC="ʃ܋2~Yt [@S@0ryw$d Kn\v14 U;=dV*;'\R!U|`Qn"LOM GyeeNV'_}*pBCV4i&ZS @ieꤨg4a!G|7ŁpI1 $r+Dt( ԍ#@iEs]IG6 QCw , kD2QbP9n -;4k LV.s̡+BV#mdR8"\^&xւ*W|I*r9B$Td K xF7 -Yr,j"{N"ݵ!ӛQIopw"G^i9 Tmr[5|Zҏ&kҏš ~g|,YY~SqX6g2^fE6g |$ 2eԱ^:h_cBW%UO'1?)>k9,smDw\k{Ln'>``EYܩYXIY ZU|WuWONTR :Ww};тMu/ntbe~NMİ/&j7*~tT]+'%&SR#R$DdW jT0de KoI⛜㗻O vI F][(O7^9q*w2tmγ Z ܡ5 lwD4;@ RIO401x4T[c*2J,fm>J ѭ~IR{| 9coHlߴ_d޴6ke+pm5J~{k[uʥ>yO?&]1@CG ИAoHsߡsj_h"+O=253!-cE{";.މͦ`sݑ-otjOzTN0  CRW e8tX-!ܪb#H(낟'/@[Ri×ӏ @ djv/@J$NH8;&jl{2::!` sjdJa`04%s~4WHIl4A4h\{ѐx,c&FD*> e>m^s  6.4Є災ڽHL#,CS-??/or6bjS]e JsÆ:r"MY|9t:hzD6{1fz֋\0gŃaGG.EjU6l{!ف`='`K9 :  9ۃbd cXeѺa7KKD+`g?Zjʃk06d,  PЫ/G>8 *@F̋;{@BI4n&xX1@)^z?XA"s\)3*e'gptBO1!d1^$<8\% t8{_/]՗-ɣ+7l~5*ՆW~$.f{dXU_xֆGqdN`%E2< s|xL3\L"oS9-\?`T@w&u`{ !,f)D$H9 t*2lFbGq\uLe|8Pd/l&ӒxrF[,Z8E2c `V|2o6{E_W֏N. lWY8l0 &w wi+i#e ޫFh14ؤȕ+#$@ŀ^F`]B~[H-+IJUiHH:*~M5q&{6 ƐݻPU<G0Vs[h:e˥+leQFh; ֗r9ϒH:lBiǣVTل}P*OL$탍\<-c%rdBw_VI*Ԟ*]R,c R >J;^jpk7`58 'L+}> 4'⍕n U.#]5OdƵ8" ha&a4y }ZH_@n-ڪs,"q5Ygb ;:5:Et)N;l32<;n='[L/#븪E%g񺠗TQO%mplVeC%T9k/1L/ns|N؊zol>IXObBp1wN;xOc;qT,|7|72!):9O.as:Hfxs@U<}[wN;xUޞ?_b!;>ܽ90N<tGp #WA6/ k4#0 (D8Gb YEؽY> OHVlׄf1x4x\^zH/vB%8ng,!R,@ERQ*JD+ۻ_-qPڼ$>!66P"t؆gȰCk٦)ň`7Ʃ~z됿ؠ>b^9!5#L;: Htdg7!0֣͞7ؼx?@?YBN,!u F` rlf~'q5lj{R0]χQ9]e ;Ʉ1hN@4ѼFVo}1ýVDtl,}liX?1(.u^2CtvJWJAP/;$N(bbQlxU/F'?Y(y(yth Ƥ`C` Um۹a[u@ŻH7V ўꠛAVƠuʁ֗T c4!6Y2<` 衿?l .ȏR1"zCąT >mܪ*@d*+d\ܛ'׳? U *Z024a$azW<q8חS_Wm XȀ` \w+PF0~ 9Q+@)ǣ=2Es|e7 fP+^s{eP)EJdm s^ Ϲ9z@jYOAg6nǐYXg.Hu龄X ; :uguvsX&dDQzpl =lLm@ezc#0qE6Me Wb XOME)GzqAlX_C,VU_0)2-N ?=\C1-%f; ޤGxg.=3C:9e,zbّ{F^ 0Q@޽P4=,Bf_tsŷ z-!ԮX{hrg1rN m_߼8묪_:)Yߓ ;f#LX[#a-vBljq'm惨Y967B +"OPFY" 0\9Cq'=|dܘf1ؿeP7(3ݬgpb԰ zCH%0t.p=n("F,Y;!12,Dx#̒\rqS Pz%TtKٗVNL._,]?,SRKإtpK"Ҵ3.?W2wdU$ê0mPAܻ8e˰ Avx M"o…`N2f/,MrGqif[ , XW'ؘLx<3$\|V+#t\9jKZz}ZB#| JciAZG^< K耫VeȪD+Ha/!7#יrJ,g;>~=T!}+ئ ݆Xmd~aDo[2Lܑ.I,Dy,,ex+&?}$En37,N͠[:U6:pdjpjyԉ/\يpxYozЫ?)cb` {"Q7B3hr$&CPp9#  `"t"Xm+ s32~a8ꤙ Bo9oR E]*$w190ܾ1U0*@.Y EkUbٔ1I7eOBV?"-p P vtSwM Zo8*wxX`NLIdgVvm]`ehGo/&~sy/Ŏ 9" e!a-^*u^3xȠ5euvMt  k›Y)0ȗEyנYWWAGO#a,'n$껇)ѵÔfLt5:Ee ᯯhrG3#4U֮/Q?ʞ6BDMʡiǛ?nM ڲf^%@/`gWohMBYSM s!R8ڛ#5ξ|Hj3l ;xUq/AE߅qAbcm<|y ~Xfɬ́Q#mY=r+JEM|Oy`=ErR*e*B[B>5^,ewߗH::%>QE|L J B*rh'‰ےM7)|(zN/uW'=Y]Xwbsk"oT>a _07~wi-K?>ɇ/ZKOa{ _~neFKq"vfL hZ::VF&̌ |6";ytmF6| dӵOb[XOf25b-|3xEEqh>fS˦֪ +>_IPԱ(u~{VagJ٣?ÞQxw)ډ6mm|넶\[quU؂] :@9Z41NH1dug@ S;1YNV6a }fgh4/0m ǦÂ: p.S/W|dוj?%zUZf[ y^0V;6[s9ҊXA%[ce'4qVwlT~mW ]? o]_ LTt&l\ o\5*sP:avzP }w'`@/+u&xuL]&@,\%{/orBRCK|յ,C2 ,%b*QiCh.jb"lI4ȣ[tb. ڧZ[|UԀ!!4 B!Ҋ5H wι!(}f{s?x0Z&3+HOCg$O2 )y oj0_ٔxN2EEQdFGΪGqЗpNcR.@kRkǠ`OJ' +n6P^{Qd\JNntq:oSL"¯-xV-sײ Z_&ulZEΪ ٔHzթP;!.uI/u ǥB8L&".@JLxw7^v&|Hx9DfPel}l] t;p:wdyhi"+Qى*ǝ(޿O)!}u F/c^MB8qլحכC Sնa451ՔcF|NSš1,~+`w&a* "ol/+ƒb'+}[ڀh/R<:Rr4'F#gu?jHX'Ja'@\?7CݔF㯻($|~]=Q I=ݦoR-wvy-G-oj ^D2JaFBIg=/U)V-tmѲŰ#7s\oQpٯɣ,nLα-,Iwa\q>6F|T==v |fV3[j5s봚`V6U,#>Փ~X<-OsK[V?ږ-xmߣ[\w%v}N4"cnނۄjP^=Fk=Jtqb}ufOaQ:jf-I*>Dh%mwRPX"$|ߍ׶1{;hcD!8zն nQ'z׸fR7I ?i8Lt - l!-y+ ӊEaRuGmL`fi5[rGf?sG K##MC!r#bqJ|$<}IlR_H*ٚws xvEP=Pg~dPq:TZpܾxk<7rpREFޘxG: @roNd/HUM|򊄼 ve˜ѩl/Sl ыxҙ8j.܂ i!# yk@(l ߘ.{  W^C ecdo ۽! G4nõ1t;eBy6 6M`u^v:{ʢ }6,d&6+-EYёSWXv/b+٪q[=/v$X滤[YS /3|Qoc%"z?O=/kW5Nۘ׍%^"lgdxߡ sh'{>ܮuok`ԿJ86=Lh-J2hNOi:yݾ1QWN teo"CW>\Oa`ѧ:'`]|_ʈ]߂WKjdoiτ1JT۪&^Q*2IQUpWXv& צּWmˆ@ zFX؏$aIę .Tx W7쿫y;|Mw-]J#9X nΰzQ6~ C2lФ\5锞j/4oD;h'1~Z+qaܭe ?l1q4 D$bH\1B~mtV|5^[^o|,& mN),,躜PN/c!u]G./𘳐:BnXIڢ#D?!{g ,GX<tok'eGINS2X8Ʀ3 7Z ,rGPuIz-/@\$_<P7vԌ5iV< 8lZżbׅ2􈙬4A3ڢ 2jzW`P:# ۹7՞15tuA=p-g0t{<} Os LAn}|q݀.UY̋ZgVN;G~LtBdIl2VoN2fJo\w+}A>3ލËKW,@/EeњC\(=c~قXQwaM-,#:%ۀr7)%ĸ=cM 󕠑M§@@#k <XI!w U.#ga(]e_e%׶cUF\;ۡ?I߸tWٻK/a qP) } @(34 1t/ibl~bt).1^k3O1+ƨ1~slH6-*h;ma+ Ya^ߦf`祳_6ՌAÍK^FR֩Sa]SiJ:'ѥnXdWHnv^B^MCqaH쟩uv⣡Sd vj$σ1>E}S'_j[YPOf/CWs@SkFE` ?oLC>M9Ggcq; Trt Ur=i{t\7>\/8L9Ua G'ݎ}R֝wfkP3w%jR;o"gMZC_GZ%{X~Xg'M2M֩[7?iݎuOY:T]HΌ|P IyqD]ǪDd?=mo/Lp@XʍR^k;Q89Q KRҝ9*&[mgY q]F HM(ήY*gSXj__8nX9iwNJލOanm,4`x,iRPe6[TJQFˍ̗U(DZ v[sMYaVS ȹg"$KvιC\n٭/)0|Or=QQ_|< :EdR;A(:AcgeLA[_7bml.XЋamiW_[Z1c 9uok>5ߣY=l춡`2@0 ?bV]ЖS|6wkf>.j*IhV%/|MSu²> w650 sЫ0.S_nj69g90w\)NˇˊݍG^w敻S*7+ ږ c[q S&̀Ts}7ldF=4h*}2aaJ+6cφc5Cs\R}Ca?™K^x+J_/3t7o甚wCj*O^ER5FQ}O&TM+)=60ȵ1in'x@PX/kFsCwÿ ';.;;hӹGr@> b-VJ4>8 F:V0RgWmABY:G |WJ9 ǐcl>âmr\Kesyy ^2 *e|)xXXa2ֿfn v 5.@5]c lʤr5?$Uno(UwgV hW·M?k\2f }>LxѬ`P߉,E9 DԜ &ƌ_c*K l͗ÑtXYUC3_6x G8M羿R8RZl*geN_bo) %Am4QZדBC-;-"soƮ//K {UF`ԉ[xSP›~`" pkW*Ci|> Q+LT$(La_Zj0'.1cуY=- 97z+s"O™jb\S@E _^g!Eڔ)?;.D"4>pИd?zYYveJp)^k*MY ~`1,$JkVeƓ<{"*e&+ws_kux\^NJ| e$!=1wŗ.LoPh+T"V8Mp1V9v0sWq.slKb7: rL8 )Us@'0[Bɹn-Dǰ%0 !Mq5dž 6 wbiu{YpD`b&4u"\B4١vCV<Db`(etNQ$R$]W<]+ u,Fq /8DOF]<ιJu_Xly9=rE]wV%ꩡT>2:%"zbz@H `AC5RN>٧oQT}PVkx2?/3l.k!Xt2C% hT8JE!~d DuTtq*4 xz={Ǖy@\w'ic6o;"* _u]pIazH'hNq) u6eܝ1`e \<>8"??B2-0NK RO4]гzQm5[־V- RK -B.e BZ?{lC(3e*a%F:^$QYPEc)b\7D6c!m+nI`: #s&mpHDfcY[!dq*$h'=-4 ſ;HvHFOZ2Уf<~4p}dmƪt@Rծ,H~׺tHѹg/5wy.UdFWE [-!lw:܍qiR[KYCZuRw$+u~ϊzQc"jīu7qK'Ǹ(tM]kkߓ'C-d(iZ6ͿWd:>n6 ]&ء.c&'c/<6G6oƒhG(^LH؟"PPL >lK]x()aHR3'M<2 x|ȍD ,4_`\]w|o/mUoMH'1z5RCR?laNyE9lyA?wGocث98D1WƤ w4zwt1ZN*Pt_j|8ozIeNc#¼W2,OATItލWXY=cįw(uwfK3;޳ XL;ɪ..|wWаF,)wkrs8_XP]VfVIҬ'c-V=GuiAV <)({?B'#̗3i4o͌Zͯ@P@ؗQV{lJyyl9l C5|~9l\7]kƥ+Tx{)!-wXm)[f@PfhlPs\o ʓB⌤'xEވ+Q)c7-Qt'0d}v@+rI]1Cj?Ɲ)P C/#:ή:~:+Wݱ{I"FQީ5-I\jfDRm&+1Μ ^4҉}$3;͌(ܰ "gDrފ9^N!bfm#%/f gJ`OxcnEZ R\'3_c04GXV^/D4WNsa`k]r͔dJYo RYHkμ?DokɩeڱӢB2.]?AEag^&"v=8[/UH=6ίt̀P_)^3#c}Ƒj[rxAЫP=} ] ta5wkañWjc0D8gxk@`CjL< ,ںmfGѝGJ p(kMrH6+[2uͰik$y@j CSw)@mNF7PX 5MPfJŌDV[͈ӰkMwa֜I5moRq(ڏfP;bB@R=+;DCPE-?.EL7H#%l@ұ76CNNɀ}ؙX7-]r0ճvnP& 5<@Y@%$ 3ԖMvdU>V[MDMͱm_arJ"7nf^rE@ Y ]*a6V1JK?;:9a5nRdG"{~M!;ԠI f ^R%P-K~cK/ BVDTE$(% ȐQwĦ~ly\EwWhhS{tp(Qp;&euW@P)'+soK-\`_HK%gI{|=eo#o:C=i`狊*I:u^i4AC==oC~qnI..U,-ӊv']5M8߳*V} /P9(ўS='g2:{^<bߏ5`/$ºYȷ.X{1-tImMImщ#Ԙ7RS_^@fPMjy5bkwM+Q@`0Peؽ\٘fIq6RRR gٛZ V;BmN?~?if|6u]qlq7!MZcM%@μ Qkb <;ϳ'4FLjЏoHj-7m͍NZ_?V-nƿHS?t4qZ|h;ؓP;D|}B:wBK.iOɻӥT׻(Y@CFx+t(6oΤ,P\}߱{ Xa>kӸѐKÛ>R2ds[ףpg-f25&Bb%9^w"*(D qoB Z^mOs `HȗcPkCu:ёaBv7ꯐ?Ywi]&b}'"U%h2l?ʲ>fkHdQԄ|j V.IM $;1?7Gr]U(pR)9h*(;9]tJkޖ&gp;nwl"Cr3*D!G'k4U`z1 )J EGJ@}8Mcgp&qY6d4NQ< cp#)ss]D 1ТI7Wr+rj.F]Ϫ__d[)D^ׅB5,MtWq ]2OٰUO9!i7DKK#ulN`WaﺸCcECjSTXX]#-Xջ 䚲@Za.ʗ&^fFOFDyqT cGJFa/rWyj(os~2Ő%vEj.d{`XM)ʆm $OQ U|^LvV>sD[ZSBM./W2UVt3S{OGiK+d\4V2iVeT5+Nv9 Osx+A7ʡα?EN҆>t]bWIw[)n?uJ_ /=hw3}&W똻 qOca¢R\wdcSJDQ֌= &YyG0X7 _rKugsl Txwֱ V ʧ;eP"TFaAu~CБ;;F>,%ewu C@9$ 1YGޞ<%y$c>5儴Dkϫ6? hAIϙ^GOt9/_&^4<` x0OUWPd2FBI{g$2>_δԷ?"!Pw޴ m $1,#>| k /@1ϓR H~6EХ8`Y\cOYNG֔62GgcWwL'Dxu!B26P?Ag@Uނw{'4 }b/됃 {e+ #& x7]EV:T/%_;Ҹs7xrVй&ҽA1`-X̞N>X lXh¸ 4E<rx_&_{u:{A[~ nčXfj)Y'l.ڽHMns6<Jbܲm`ZL%8dV:f΂} `wN=AN4_΂}ɶrq{zv伥xuKxsfVԾ Ksw(5M#T@:}TdGigdoo\\bs"-8zEWNm㼩.(cNG7 ϡȍB#9 R(s_+zItCdq@1޼jRԯ"?Ӈ': k!pA{i*KPԄJkqqA#;~_' %W|_WlJYԏpZ,4ဦNw'x!B((6DA)3wH +~, ? t&Jz$j=q# =[ǴK1eU-\ ]*F5ڈ5:Y^*fN\ǭ0Fv)Ie/1M_N(/)IhE#Oa)<'kY!ɤpЈr@_,Ys(*ú5}dw{-x?L?ޅ$1UҴ,/|GWya ۛDUei6#-^?SWAߘWkGmtCJ/ۻ}#_l׻=sw$挕s2U˕p˱59Խl\. wd,,;d@i |!wۍ_d(yܷ sLX}_:^0Ló R6 Zذ C2 NҷMm" 4 Tç&R7R70f (k͆xpzn΢ #rr^ۉըCci<Z$TTƩ ׇ c<=4P&m/*Ӄ36OYPO MTzw7*[g' X-x~9Ca teF '{j ~7Oؓmcb~ToSN?&25"=Rތ ·ͦ6)~G&HB9?p`L?i"1`Pj^jhE7k猗s nޡ-´.?5>*~MmQ7ހFr.tD9F?'B@p[:eR+ZN'?O BUtIa-:`th?6)~ljuib,K3>xٸr{u'%{Le#r-z=Q-{ u !IAFK: ΍J=ҳ:-p->\| <\`҂ZeӃYW j|mlxJqm͞(0Or&7JAOm]\^GȂ)q1I񳐉8b5|wwynPJj1|`e40-iO ]ױ²p/FI9n =`OYf &; E͝A̪"y[jGʑ&_oD߲^uQUhldxpd\5ᾐ uJMnzȐoTH-7}߄S^"g7l?z Dv5PXLUjYjJ7lRӓh'ūhTXtC-0v7쒶tfH6"/E3t8zX!ePۜ}+.DXIAԔ~߀,g X:4+9MI=v.-sJ>./a 't-ڛ/dlz]S?`;Z*%2Z=Z,-A =AO*L+Mek*f~èMˍiRMje,,BK~U0}YACTV|TH*K\{CeeÊrj.^N[R`Ĉ2l̈; `pŋq2EoٵcF}*,++8ln&,.ՈcI՚L:*Qqh"0L,DXNx'o"z碡Mhկl*c.:1nktu5v6- d(HrFf~~QFg7Y}X&?@:2sNe~+~$@*ﮪҕ2d\ 12hJJwqzZ&s .26乯Vsԩ|}#aKGXG{tϩkH.px74g7q"oV,$V}ء*O$:f8䆐Ceޠg/$ɗc>2nKs3D:ъ3f}P?ECZ4±…T5Ԕl&L.86`xhCJ>[>ǐ)}͕@bS9~4q7;l}ocmSuKpL\KY?Oe CY|C7Ag'#=ј$.dFB~ Kolŋ;aN 0Ke#]%IAsn//(y pR)' 2_Dl:m}?2 R9_5s/@~䥹))O4ǩLWslʕ؝!(xg(Ff'hΗ&4ך9 9>A؈"~v/hhڽdlJdm zhc?YKHHW6Z4V㎓QO9kŞW%؟o@U*#a=:A@:~޸#^)$h`eʀ:<+>ކa*|D^+ѓ8usnv=_ qjC{M9=`些qux;v#mj{~c"Cd#5mC/λxqru_gϤ S@ PS"b_@i*E?ӾN .Iq2 &ЍӪ+l}kJh ;zQ\@/T\x"#?76tJq]iʚLK֨_Ieэh. Y#4eQ>`:}19hg.F.}ږZĊ4A@5T']br?s7}}fܹq93g'U.P|*Rmf%֞[r3nJ/s|ǵb7;)n"6 28jO(|}PrؒB#x:dž+_h2Xml@G+ob_.lbp:{|0ny0t? {>Z;}׸Z%IՆ(T $8\. =}uJ*DNF+~Jуk ԰xv5RXzǍ?2{⭨T9J}YM'0]*DEDҷHD0 y]. P! cLN$P"T[G"H{&b#$GY#ԗ(cjk{ie"&P),^)kP.D 3xR%]8?d^q fS3W8א 4d}Z'A2' j55}=%< D?~Rdl4yھ1%ѻӝM16:|h擆1%nls|CGY5=<Q%0ӹR/\<;3}Ȱ7_Ǟic&א٫FmDO/DЕ_ 鏏&$0::5&$F 8≳0 tN+ [S1 N=< N 4 8l'C 4ǘ+1V3t$8&9Wx=N͙%/]Dӌ*Aptx?F^,w@S([+Gr}6Z[m9;QrӣCW dKM=` [H:n$y0cxcn gؚ1/ -O/EМ*zS1ax qo@|pٔ⬥ܩlJҘ{hf)CBoJ ''|hls2k/@|r˳AX}6#ӗ^wA|Pǫ@Hvu@OU3#zu5tB?eƺ1tH O"CdӮ3֍<fF@m?NE.cٔ[jNa?٬CeZ;V,J|T~4(rma|o=Z&auɉa:]4/?,\ŅYT&La]f66׆@- N D T 鰺gL36w{;CMjC@7I=cSӰ }p[ :>uefc7fpj+*7kL5G>XJ);do;J$$TAg eS\ Ga _j#5 LI8rt-șR+9YnTgǰM .>?x(]]mdo"sN_׆e&56J"R1)6Q0sT?RwKԢmnO!K]Jz75Es2]OtU"Qapԁu5VWw*Tsmy_vh“F(dFIw(XSS:}jva9 SPﶉ>JV1E\7ǽVQέo0$Q/z @TfYɊ^(jQ48:ޢlv6 e-&,/SEmĄ!Hq5Z_YSک;lƗguJ<0Ne噸HmÖ>sYw KuuwKmWWtqg6>g{ŵzlՂ핕;;UE "*_! ̢"ݰ27 f1 x^1NU {r7ų̦RQm?JZڥ9b um:$rT,pwFRhi#2P&;5@Ҕya}K ^~%U^b1+GbX'?hI=`czç 09_D.Ey쮣3,Ten4\q3GkOh=L<5hNtAvk^Q6^AD1HvLwHgkV̂3{AKN:HAY@4m Gc7ǟ*Q>=]FEUMXl: eĄPSvŁVE'k4/6/45_kZ~/@Mܟ\i )h[nD)؋X~@wv{oj[Q]ivm([Ѳ)vZ kE ȚСƎnߚ.st%ˎ|CD?(÷'9[>CM5Jy;/ n)O'(cvגji]M,v`v@eSt=]ϲi%Dk׸h|B򧴶[݂C*s^2 X Bi鎚c_譲'q%姵&ީZj#ytWKW%&_M7.LLq⯣+7wCf|[%e%ʇ*+X>(ɮ кUg챼'e#zę(? jA j;VKrP( `-ʻŅSⒿrA )3[L<)-6~D1id˒n42Y5E\CO[b߷ȣ[zU;vTD<c#՟;tCl'o ٚ&Rq ۣ3^=Ͳki̼.PEJEK&s9Ͱi;2 TAz5`~D(2njs*EFUٓbnuhl*Bv? 瞔OsGfV|jݧ-;` |wUbUĬbW%V8rn*neI?FIf*.6>Z?-~pNR(J7l*es3G x2Z#(6لsFFSYbg<9z)>X LfŃKrWFN13'V%Ϣ&_n⚡ToPov$*W~>'<|pl{Iw#ͼ] ;,Totj1Q-G^B{1}%PT05E&fe2ssf&f&5ɮѾVK&ӗ/&WP*V0h+˷_=bY]|m sK҇Z2%AY*4 AYβHpR7_93czpMCЬѶTXNgD ]7̓ .ev >յa䛔M8H>YFI0uFN-*[ߵ!Q7S;b-nR,M2N+4`vQXVDE(,3}ʥ!w@Xe(׳r2eed G>+s2F!&amkd?itj$:PÀo&5)1Wx=͉ [Ey\mxCT !s,4ïz# 9|&ĺA9Y_Dy7T2Pܒ2HoHޢiSk:s!v|4?QZvT$UB.lQ_! X(}|pArGh\g/љz%LV~M%y 7{`&{H"}5Zl܎oyQ{ dr%ӏײX?$f;(-Y!(~GYB lיmU׼2^( s iezuN~bX;"<\$4Uv{L=SI.ee!%)LЭƅ! V_0btJ-dfDj}Z+ڟLjo#8h㨐60CMއ@opY}B4b$k|c8c4NM1- ڭ:G0 3(G.l^dtONu4vZ@1Df5؉y GxVÇ <ɎoCnuʕ9`L9dǷs|1m96:7@|F}W{?Pk_D沘%$5Y )-jcr~=\7VHI>~iKh>_uwSm՗ ݐ E&XLEnowZ ˎ)oRM4ͨi:2=͙Tbsm$uNO=p^K^ 0Ghm]BzG #r~2%PuߑOpI9l8%Z &4AdZ5LLj)JaKLXF';Vhw.BVAٙ1 (+pP}O 3fD#z"WkBڹ]q@I4 @:+&ֽ8@C@4)ɰa:+9YrWQqoq.ՀQGP͌mpwǘt%rQ&'u>}03!V|K #o U1} &=<2EӨ552̧OsSkXrYT>$yM^ [OxX^A--eZ{-uv1/2SMMb-Fnfef"9^d2깂 ilUɱ 򍱩Kzɇ)K\;xjl$WF/BfqQ6ˊffs2n_1+Ŝ:ΠJlS=nBjDcA0 P':p4a**ȩ_#qVΑLVeCEڭm4)tm#MM4}8YRR%ڮ @[(lnC#*?u乐RRcѬ|G-?LmȦ3īZjCЙK +v'adS>Q<WY582Oq)wU@8;hVjrg-ZV-5V1(KQW6qғzhq bD֝;ԕNuCi< Wj>V~};muWgT6jDDh-RjtX˛yVq(Ĩ"_e@-RW[EwCĴF=7f$^$>epH>p@3#lƎEKp\tX:.kjfg< sF=reW7i-9`6|t]#EUTJpkrpU}|yB*^dWⳕIS\cH.yO~퟈oVkp-Oybו3Sϰ%*.dĺS3Z>\LhLqkU/2@=Hϧ4_&+hZ1,o-s 2]Js.&]:֬d^>[E'Z -aOD%sp!|tSq2>VJID:|)fʖ-iۮx˦"`/k WAI'rEhՀ/4vL (|o37XLZC# 4 ԏԩA-Q۸{`G DDٔ^fWZjQ^?^jsN]njz^  ˫'`oRQoW/J3^8 ۣj`!"y)v ej[]9M]-sǺ3+3_p,grh$|c"r{`:@k źc4s׋ ʆ[ݨT Mt*Ne~dvc#SQ'8>/"^;10Zo4g.XaG$k_40Da f90$h3>¼] @Rhsv`zN sᅹP{|LD!q8N&5aF΂t%!ˑfwd:YDi&I0gqV~oם{x/4#z? gA%<*1*`;M3,YH}rQxU&wdNVIk{Y>NeJ/*jr\6;3;vyrgo&yʦ㴺TGl0x"AU?mZLJD4̯H{JR}TQ X`_⠈h4S=s5A]!%c,P*`}6B|HpH(h;TZIRYyz̗;Qzq#/"nNhb= ų +UZSgz2? gkޣPc%矢ۯt{Aߦ:Oq7-;-ZEf4 $ؐEq;*Vٱ8ORH) %8lֺ~t>N" pqNjglq Oxt<S-H6bӻXLsOQRh?z=m?X+dϤRN1r$Q `8uO*ڣ@A64G;LgKУH9$CpdsZ~ QX,=FO/:賎Z7am2egEbqV;v"VǨ^R D4'Q :xK Z j#K 䙅:pE8{! K(=PL:4X|"}Y>>YgYӞ^w2K-۬pg 5Jgfv8{Ui8Tǫ\@)&]mѤ}y!qibm9ÀP;El逨ԗi%(S;j{W/9v̋ I䜔<3tHK劼Pp}y*{d]D/XO ղղSZ byQwsm8#8|Vz ͫaGGJUvL1n%ܦXF`epk6VM>4v\t n-5~qaI7~Kv K^VΗ7 7A&oIuXی. eJ [Pbw䚠>}vc|6_]$cbh/y5!wj ~ܱF9kXZ "J6&Oa! 24lkYiت!fCR'JJt)[GiV>L6[>V65O}|\M3}.H n3i=&HVB_"51W eBӸC sѵ`6M@ 6V e+ƆP@ZKgS=WPg%m;L\K@%DQgGPиDtp=6ARƒ&t,ujRi8#{?&RxހEX;t#QFE+jHob{I[Mm>L|ƙ/RsˊwFAfuYڃ<z5w)SL!a$^{UnkD*9^cqUPqc1z:_^[vUgRn#uuLOZCiO`+غ(ݦ*:оI4Ġ+۪&:I#nu=w|3Olb''8"V11NB~7j Ɯ{-W{[<6WUF T[п9'宍㱻^b)ĎH-WxXj[By>[ ئ}&mg X3)GYNړΦ.e0TwS=k0J b/HJa=ݭ@p^gMsmA\1zJ}Ujoҫ{r'sӒ_[@ҙ(щyt&Py5_~MBqk'J[.E#i|DBLC6RʯE0] pP#qk2[`c{Pd3-[gu|NWЩʃRv[228*5V]vJ.:(=k$9R Ml/m?(S\b[%St/,VgS/ve̻#q}]$[7W@O2YY4*'S!* 4G>p+VNJ kcEʴh}LωNRK0D)4  |E֨@tO(+J+'&J^N(+SlJQVr^9c apfvO;5 &rw׀R_< <Պr>!cܦ8a.W1ⰮT\^21'd3sL5˹ZjBmJDLڝ̞3s2y۸M˿X9wŒR/Ѥꁱ毼.3NN ZAMqK6g o\o U:E3]=D5vSM8 M|kҟO'acRܠGz%,=l j4"5[SWH:Eє|jZu)yQKUؘ #pu wJ 8=v$a%XWx }c&X0dYRU2~[b[ka,aPI $f2@O}HmuF3Rm̞dR8V`r $ybOћ4ty X})V?ӄ+<($ŀZG*~ >GM '}F{NFpnsaTiZFr!Hz45:;^0 YvIJ=$>:J{;5E{d$'e%KݯoR)>.Wע9噖9jCh[Sр[ڥۈ>z9{4 Ե8qMv%w:ВꦫuG8ƍÿZ]`%S6cˡ| ǎ2bFAI^-ƿm\>eN< {HL~IlFG ;-~KeȞ#ȣQa ݃y\Wp,Y5Ǫi?qFr~i|fk g8&) n@j>oa\q0WfUJba޷LݍK_U pƪ +7{L~&+@̼;>;@یdn6Xw E|b5w8ݵ0 4@B[K7 L>&_-břL*;FZl1G/PKKؾ |9;Cy v*XٔtP+y_1>6V`#λ͕l ;'թҞ2ƙfBUXa/@'6瑹zb6cJxOԨk4E.=UPrMP⏶:ߗJEJT)<Ͽ %}Ӌt j|@$6bD}"÷+i^ivkM;JkmY'9p(v Cp3Wf, i|pAC:W맷Mqƍ3=N^Gt4iwJ9&ԫuM[Bi[i'>_c +>IZ6J}=t'bGnIA駺>t; LV2,X@Zנ|/a-]ۭbYAe/K?6_/{ mǬO[ϫ w.+y]ؤiڪh/|Hr7Y~xI=ً=6]^]h^SģĔbP`uj4.` {(3U.I|ҶX^ .@C@Ak vzs'%&Z]jjLy?[Mvs`i>/T;c+cpa9Q {)<:X% P\g^oX[ԆWu&{ I}ӐoiͳO儿G\-Zs_aD>@ˏGpHKLw$ AB憥+1'CfSTvTĒ+>žil`;Q0j{kkhqVWK6?Nt৉v@i!ҐҢמLJ \YVd~?>G@q%:Fp0 ̖ZdZF;=9;kMO*;koUPT|~mј@\ܣA}] ז m.SCw(bb47W#Dx|,r"MpЃaHIWQW`@z4Iޤd|fe^8Ob l'; lH^IU%Wĥ2#yb"'Zg{N͘Din;\'Nnt g%-EkYb+V焎*!PIPg8nuF:#K1E;!L_H VIӭYn_ G{Ri`pvotu6 6[eML71Ľw(BkxĞxĒ?~`Q%.\]9Ԩ[^eTEVYv޻ډG9o1뼡zRIX˪:dwˉ"7=? GNC0 D&%@j8`mNm:=]ΈpvtvX-0jB^8[ Hehi[Cy3#Nb-3 )PØ4WֺLOM"]x" y1fSkr[3|lIĉ}G`u7\XH: d2dGR3pͨQh%oԫ\_JWU2dza[ Wņ;VBӚsj^NQjJDPSцcxIAWx9=mXlÖ^/!Wtfc&ʯd36$@Lj T7g:۳ʢmx7Wl16j-˵L5/TXAҮ!UۍhyZ7צ`,k}ټ2X̲k2:VzC_X41U-13,[\LgY❲\v[i+Fq\3JY*%WKP!ni"SOs1j"\'#iSҰwj%hăuxsۼW!}*g5ngub'lMZQF;J0mqm_Q?nε*! Q4ϋ%m@=a[`e o2%l֦ k+|G'ƇORqg7<'gfV+o M+cO 9“Ac^0%{1 W6vZIz*-KQkŲMS5$6>3)tw% o^o@ OSsxO2Z4VwS D|@:;|*^FȺyZ3aFv[ ?4q'n7OT{\I:k:ܝz8&V0Tk{6QBUn0&/!lUQYB\M_帇(A's>pÖy8˰ x xZ vy;@hB#m 0ùClR)v?яɤ ;7q=JCglI]ykj81Ǔ _c43Bֺۨg\>q}#! [^)$M\fs'_ eRayE* dt:uբ+̆((ֵHx6J>h4e5JfYo/k&aM%vlF%wwČ`~sLwE!P.amaSr :=t8 :F2:JlKLǫ_a@Gx-+?W)q H@ zD׆;^D:8TZ *Meט!- *Pk$l<86{Թî[ m-o~uӻ0?Bn <!hJ٩-P#"wX7Jd<շ_Vk_)`;\$l elZjy7[ ŅniHۉ%M!yp*g/ʏMdJm<;n 5^Cgw7ֿ ل'[;'R,y KG_-BUNf{ь p?gH9ĝUb(/VkiFϱˊ߃MRUsU@>9&e&}=ѧ6=h\<3Hiܞ⎯n!V*4q?;UbiէJ,H("M )#ϷN/}}u3CHdŀIN 㵁m8d" xOR&짂"⹕f<~CS۩\q"#7 s}`{DKKWdd­4^,_{E"qj@A啈1NR})}'r^K 2\H^kANS2"N+Ta"_K ;VG;G>²iO^5l5o:y_{O9_V#>Que}'>Uaf=u6f0msšfdaȂ]EUi=f 6q6Y! _Oڧ 90sVxR<>G?nXG|_|b-B᳚7 iP%K\C0){xN뉅µawPV*c-QJ7Of;v`4ifSr"XOH;E}W}J V^BK-ūg= E-+z\n 9:~Y`S|#cb`/?wHs![˜KsVm:` 8 U;ܸAb1?#yQ|{xV]#SEy[CMvַ$~#À8Q-qhIK JY^ua=|&?M8Re yAr BOts7嶀CFnՐr~ЁqY6jjC.` S 5fU W;pB}8f]> )ڧ5 HbuZPfD +C,j3{6zSS3R~'E8~j? ytD<;Y?@&?qX89p03 X~ONGD5D'oéHTb/r[NvG{x+yH*#qCq^um+eE :GJ4]`gXϚ3[c{d Ac-5ϥbC1f衐Raͬf&o$Oݴ0|њTETڭmȧ?u>xxI=e屘t[4bp'F˟kIs1`5.De (FM|F9'ĖnjZn\͐uk0Lpa(sf@<8OE()h !Yt>aؒ!.}iqK#_apwI 1{PN~Fo5z < ؒ&D*z{||yH/+/6T\+N Pu)eO9VL]7NHspNV//4Nq&K Tf3Zw2nlK2uf8enmi T'fޡ{|XUN?]x " wEŸӺRsY褮=hLƇL=!=9{:Gթ^Y4ul:8O@WH<8($a[HG]YQJclyHg1 &TE. B7Z`|ʬ{؈F{jZfchњWv/NԌINwt0"r%w_FD[iVf1;)B_tb`~y_ioTDYD`*8&8W/8 O.o\E w5It Xglu^6v3by ;ue^xf1h2M'HXVJ X;0O߸%?R^oN#&q,J%D^=lzĥjC -n|G/DV oO:ZP# 9$e"3 hݕ#'s6jṬJ.iCP]Rf?vyCӖS;DxqݦUQUQ$a,JlHC;S=~w\0 $˄1u0Q1ENs`Oעj/J3=$yravө<1#72 3oűU߅*qs|k[DɟjDuY$̓fu E0};&}U.hf}pٔz@(Xa< =nqlaD5s9QQ,gzܠ\oV-G1mI_Zn/I"$44Q8Tﰑb^} :Gة?]XFziwelEl,O˪%V:>).4wWWWSN1,I]ɢš2WiIfhSd4li2XæOkV?B+ +y?` %zJXN[`EE}HIfءf&hnmNZf!4 Z1O}6\EI- OJ`pё%ᚫ@Žo#'|aUsOb#兴ػ>.0Oa]rJTgO J8-r $L/_-]9;k쐹avK^> K\@!;>mĀ-Mq,i V|w󭝧@ D %#|ÏH$3UsY&bQ戜j #:Yb̕kUu3 ~MZR ZVc(6S֭h'nbIB*W OBO}udV>6 gӝ)h-gPP?e.JC@ y(sBw0Z(bCfq"`Qnrc9pJ"X5O~"2m9!uZEZVz׆@6 ˉ̺]5u=ѥuեvFч4/`ӹ?Af61W/T=kcmIš8>_Tg\ +ʏzVe+)fp=uN[ RsAי5@|ė:I8!"&Z)c}ŮVx%jY'['Gy?4b~e`IYuM'WOCK} |T& %*6Ѡ&. l@TChHڢ+IlrH>j}By`C*hQghCH?3w7Aߏ읙;sf̙3g#צzL_lEME(Thh>A9K`k2m1pDۗg⨇'{ݗ!MdA[kЈf }%Fk-*=#y Tmg= |^c?Z@CYKMU`MeR<~1"S-[N*!e~:YjJzQ|e>a!C&5(\`kI;K4U~h|< zQyeyd4I(r: !:WV?I'ߨJ[ 2^9 *(Jϧ+4]hp&|P䈼D'>Jŵ~lu#yѧ|mB؏@.c>;8-uh*%^eUe WIee QeȘPc<S ouZ沩#\ӱM(qNuhgĭN8ۖ@kG8/^boSMAqD,p#F)2dYA-X"[[*Mڸ)Wb=}Sͼ#yA80%PsP`x ph3L{?*e޾T9P`*}s.{]8 jvh#}饊#DNR׊'/E@LQN1ny0?dO< xvwZzM%g{ Dʇ1J ]f;6Oeܒ$CZ>|Thg?# hhꁽRyeQIޒlKD(g9lΧlԝ$Yͣnp|Uá'A1])ubvO:ٿyg74X.1*TeZKCz%ÖCE[ 6/aѮx8=8 ұO+I:/7ӥ &!;h4%Ζvָw=CCwT֖TWA(Ŷq+KRL4"*םNo nsΟzWk<|a7Ɠ)%+ ΀ʺ\BY"@1_DӬn-3o(;h3$l=@^ _@ (W(c^j;ibtDi^{U.ehb'a='",wxcʀ1;gXy!~U_BV^ɒ`~rn Sy5Glak3ZBv>?^؊gds=)dXs SF3<9 N'?: L*럷񥯋o_ Ew6Us\/hu'kUMCCg=V; ;[N8 _.b8ciZMU=rj|oV"yW+Tu|L|@ægD$-]$_k{k]_ݍU 8Ah$2h鈂46YݱxJffتVOtL!>sg&;$߾9N%=9Y* sSЬ&+)h lrP&cOR1|TNo?j9Kx,V]H0/?5Q M%4CKV>gp_g U`и)p;G8ػ7­0cš9K璣_I-GDMr@,f[̧<{@+r{e8oonk60ޏUϲCXv#Dh^Z`}:(UGh˜U2(2ōU=QzB\K\حfiQkPQoK7-H,WsL8u4y+խ2shґ>+d?x{~V;s{L]?M⋬ќy+d=o)O!mOwF~N)$Ni LRvSJ¿_|ȖMZ ©_yк,*?Z ;q&_H=p;8ǒ=!%"%dbe^rmj2<YP,YI]`Z\p %% ~<_h,dܡ80;A2 ߨ? !h~ {-jvs7A%W¹?4EP-1y)bgs!q[Lb-̔Ƿ>"ŋHɓ OX ǫ~Wk3i(}Rf )~:E%;8h]=OA<waSNjQD?cēw[ UXځ8n&V͟nӜ[Zj&%G1]+^0ozk8rbz[jr79i^*}挦hskL3-3o)iX4=% ۃH{,yrr0Q~:1C@ XF(a/s~U-gM}Em/ s@0j[hOUpw[n݀M_wm~1hF?c5{hAr[R[4;p_4]Ɵ>#rzھՐb)kè3BrOAe>ИZ®EB]-uSy%SKvCj*)tlEC&\H\2ee"zʝDM,i%$؈{5mga.\-+ f5.+ zXyaS}>vKr|hh Y5]8E<  xѰt9ʴLf4N{4B{@Ѝk3?N^8ƪkʟmN<ſjS&|({]B9@,($ CanE+]2 ìynGtȿMvk,t E5>>V@ʂ5-S[-lX93oguןe=$e? b e' _+-}(L=D99&罫 ٵr]=BVwb uѓ9o8NoiG]/6{3e<PN?kXCj8_l`OLmЀHB_l& '` |;_1q I"$q=Wh'an:KAO[FmtwP|v׊Ndz#?禎WD%&7oDYwb$N3t\zcu/t6/_W] 0cn|ʋ8 =]7Z$+3,dmW0kRDC_s91mNa.-݀BV} xG?]Āpp9r'.+wl*[e 9Ĉ߻~ X׈ד˅rj7l:cb@~ujP}~tƹghSqhT<ívITrb `qi,Ptnw`3Ѷg^{[SIJ9@jv<:@5yƊ:(jB  ֜<~ QOB@q-G5vMW"+SP8s+h*)]Sgeh5\9Eq7/((PNn˻ǦI26m51\ MKyJoOjjw4~OyOP>nۑmlNfC9p.[[$–iyK8#fgӉt0g5OisZdxʪZek2$blh /QgzIBx#z̼w+4_;Kc fq= >¿y|boš_Y_cJz3K4VN 0Q]ƕb%][`÷vO.Oa[/,W,I!)xOxw#! ùZq+X+!jirY;5Fi@iڌ{ĒOz-~ `j$cQ+}v{zPKXYǑDw}{c:~[ T {:p+&| X"r&22c 'o#SKSҎY OY/ܸ94,]j_2xoy7}N;ОHy\N=2CswJ-Ck@v eV-~欹kӯp4i2xMʀkeÐ2\#ka+pc+HN9@$+n= -!:Ӏہd晠&YK͏4|~_E|o_,8C0q9r q*OܯuB'˞Bh7VKf:^[2-4uOvR/_Tp.x3V=֥3<8x#GW8ǧ)t$z_S.?y^i04^?$3k$CoBa=Ղ6 3*PS3$NX'3?A}+{)N;*th|S[lEeh (d-%dW܄{ؾ .H I-aDj G@:QcwYjp7m4RįSt[\,@8zҰ 7a9"_\z9ES[{{^x-˸[{k~śYeѳQ> TW>Um_eP1*EN amsf*a4/8".Bq:xOCY9`Ox4 QĚ |>*Czx ʕ:!$n3ҏiCw7+K3vwm+w=\0/^L+T56c~d6^rK_cb"x#S!R?I'II;9I=e` J"]m~^oLRNf&{Wn&~Ur;Fw)F P- bbl.D30mS3Rn*R6M~=PR9#[1#=@0/8Lc;|J~Um\czwO\P(SӹaShi,TχY]_ uZMwd4Bk]DŞ:$Xt+:J/siY~kU˝]؟q', \:5sZ8?rÑ+c$w7f=Y2@2%98)ɰr`:F%⤑YRN/A.W]rGҒnBk1=ӌ`"<)::TeS&M4ݣt4i55(D<#P+S%@#blhwH0]yEpucD..1E~^ LRI=~+*"pĥ qz\y!Ժ1g"ld]]{#eTjr0a @~XzaR)cH>$P3 ?ҋMAKLjL1HM4i|B51zf:;dQBcu:5"6x_K,|D|\;?םԝMW.} Jb}VkGǔS pl S~HYSvZ K :,{QzIFx4(?V%YQmj4MВ||dc籔iF8ae†$y:|XH;Jҏ4;L%-sXvh!B< _4e" '+AK޾,bkx;,!C [;>:xJgsIW[?Xf:~Y&ҎDZG}ZxL֪:1؜.f}NĕcY3z*Qj\(^c`TW k|ڜ[Ӝ:YsQms{.3[֏4EO>}Aw4̎܊UE3կ1&(tW_k"F+J@(OE@nJ#5a6 >8**~Ts3gs LJ*B1"00_ަG`yVz^ʩ6rKj\*:)zdnK"m[4?^WL֜zUԛL/ϥIӒV՝s ]eԻ0ZGsjN(tVvUV ^}KRMSOVwMW]q\TwC.NڸU ovI@'D*xx,UL" ڣa;r1 h>,z S~#^,3`Y!.Mc;o^w`guIRa/ƌuG J Fx@|jQ,JρvR(<ȽsPf 0IFrW0H̹s~Qwcwi*i:mNlsAbߙP}J4ϓT\24CtEү1ޛs0-tFmK{ryt]Jl%V(761{(d}=_?i&hzQ.砋/f rZ\d)|cф@|0c~-^lƁICOꔡ29sX+ n,k+F~A06푟۹7{q$E6b|^\ oAԅlD_uV [4%;y5ٚLze6*A1G@Nԣ:lG=fN bTfؐNyf~ #Ec7&-32C)-co#tH*UtҢ~ JkFzbYf\E["]7%y?_Ր5_xvm%DW`K41z>ץ$mL 5gW54zݷ8;ǁ0.w Ts4v|%4_%4}@g0 dCQ'R9D}ios?mA+]ƽ3Q!*thÆo_/>mgs8TCWAcvGs?IA3fu]mERW40(lY΢5\QE4cJ \[igSIe2,;/o+}<j)2BD`- ;qLvWK\HŞy9Pk{̪BkNxTK+o/BMzZCٽC58}rM0{fڤM6 :'2Iݾ)D9BHkRմУT7!" +v&t2O\\<׌V|X#^ܼR<$b|v v7C (QAGu`v*c%cd7RO`U/@ZCtYpہRgKӔ>B<]{-+;$SD i&W930S}N8-c_ǾfVP6EsEZ%nP)fdY#9'uC(UqI98:8%VOǠ ҁg2{vKUwM]H\w׃CV%e;4z:maS'5N'OȄ-zDgZB!8a@cз׋: O1hr rtQ)oV;1Dx"q7?4t$̆% [hn:qQ(;i]L2)1JG˥_5 QD ohXktP&NʚlJ޼-T:2ciq kV=V$7SJv*8U=rׯY:?'*?%yTq1T ꔔʘ~zO2pSP)4; S?ޅNpK%.M&(Xs"B̶I$PH{Tʶ=.&o@0̋]{΃cDU 3M(H/ _a7E^PXqַ 8ztԢ+(/flR,ԝ\f;zKӾ$e`Ae}@"C(:+ *O?EST wq1Bk_'X8GL_犚Nݏ6Hk9ЗfT<:R<sDw.E=zM7,n_N2/1ك dC̾GzfޡaGi2#Fu$Χ ?%LuM=,ECшbzaT2r)BǓ2}N]|Dy[Iӛ8U=ED3P7}G}4Ϳ%3,5=LOU(!$-YLr4q" d^.)!B:(y_:sцRԉȓ6iFjq4ؠ7|%pvL4ٛVyŷO^s<>ܖ=rEXմ'Ԑ^|lkblyaSiQYήbIr`H*?"Ce tlFQ l)70tɁ2 wа``\X*Զ\"\{- (}O~}/FiɿP=tŊv12 )*!6V 1/ ͅo ,)a93 `r?(ǷAb3,`cRɲ%IZ 6j6ؔ9UxovVKrqB&:T.9+40YP#%xM;(νDs2 8b'xyYwz.(ԩ̲ e@ᇥ= HT'.ٔKmfi+F>M'f~5`Vq7nN9(^`3*7JXbwWPucP=i1;zt]2ѢN1ɢ2Mz{'ݬ>vd0eYV@%v0a٢š?y9wj%+iJj~_СE[ZV& j/ izN7i?x":#z35fi!P.u6}yI[L||0<,c_e2%#=y w2Vץ}5SeP?Gw,fuۙQF# .[t0s~*f`  dJݤt3OTN,ǼnS ڟ~֡ }-KSKX` k;7x$Ăʷ`V8?%} A;pŷA H#znbx2;>~,hfK?AĀjIW:C[L&Z?e-~%oF?_ ^bfU;/,=<[>|lhٸ>aÅKy[Cq{lv1!k F(dGĥJxjs$ɐCԫil bPs6lW I*t1a_ vvL i@p{#װ<1DiMQ3^-N6YhicPlR'*Bp\VEV51ʪ_n>ȧ J er}z=:~0obdj~3;/Zp}'2~\.v.6F29ixiGnn?{X]!"~&*EAa W Zs_=A%YßYot,]8Jd-=fp1@&`KQ4:}RB,:&7YNK91#_E"$HuA^oh$kd:DF.MsqM)o,WCdK694ן3ͣXtU uN0Ԣv ٕйd"p@! (^ {}Fϱ{7ҿпE]@{/*{Tߤ'蟾 e%xCO>7ͳ{=TY'hIs5A|>{}07ڇoR q:qp%H8C7ϣW;`rc)VEՏ%b`ni&l+󊺳׫IԺɓ{aP3ug') 9>hk:{IS\Jk8*o;w4Ewx}nIL~'}۽`qשׂr 5@huLVupmwF[\Y}%? %EE?&1)7V)[/P{=2*Jݝl/Mr1F;ud%C>O}wt8)=}1"Z 1c{a7l!jEol%"d?6Ǟrܔ㦜\雅JAm꟩3YR~~mwNS >Rď#h d$g[+1N-ÔR{믦W %f cT6K% djd|CXެ(m%?{z U)䍹#eѺm6.4V$^?Tu!5u\?+GIɷib^KKh m, rqW퉬ưi%U.^RQ_dB_<&_Jm<<_Dt-ŝvXbfz >XJyȎNđ+a_W,emmS7݈_-vhK\##_ؑzXv 5C|`1#zTq'Ǯ({Xr 9S=>2WgЈ5;r32 9XveU6껕  K Tw|D/}/}7ǣ6uHpZLnH6}[uzK(!,,/z/H *2–'IQTA@& S-ֈL;k&W `ЍF /}6mk>j(1$o# ء!u-u׿s)Ѥ7W;R>VmcMx4vh`MVC& pvz;Y򊻾kt)` vx$ $.cL}W+_uW{Uvj|7G4_{m7ﴹ)ZNCoU #,w"  Tw=I̭0<ΐwa2QV񽽾_]\(8oE_{^F?isrl6[)ݝ7^[7j1".̮K7q q[0i"C!6ɭ*ppOLxV|8DZױuS|Vd4Y%Kn?Fk!B$kfZb$l:4Staԧ(Vd1өv^W ?SLD(KH,q2_/'/c֗gG}Kk!)B3?i d/?ކQlV8)i(ꏏ*ѷF|gpZ'DyS !DkC;Pkre E'*ܞ@SZo{dȨO̯z,ء V>\V{ֳxDrhYBܱ)ߠYqatۇ.'\$exߑ_g G3 ,%w&gqkC+-{;?u/`m?rY^3XL\)bnՠC]sx&Bu '~JVc ?P&j!-=ώ@eߡ(nWS PVe^=K[=zby'Pr)mٱy@A=Aq`qۄ\7Pz]E0"ݑE*Gu$Vc9=ȿ>sC{&4 O_%u&7Ɣ@[3بVDDbE_}_zX54DILum5Ǜf<zg ~D;xz8嶺]7 MuDw3hZ-ymXҒhO%/|6dG[/ucxbѫUfw氶W0p@|aحvFP"J^ oTů_a$TJ>!,f/FˆNPK+^:T-ja N{ݦ$fgdTn߉bFgH:?H˚S 8RяWMddWA yʽ(Kiy/kWƘ$={Dz<0uk8$Ot< ;$8!Zҩh1u!Y`[os|]HLdeW6IY^Įf ^xƔZqau(R5L抚_s,\bågcۢu8eXG#ISR^UzHd#z`|i&+(r S@8l=ƚPE SI'ZtJvA  RDV( OKu`1ҡV_'@I-~6Sxj 6ß'jac/x8s1tWrb20(e]$ӼK%U;z5wB~O:*C1:ZpeA[дָV%)uFNXGt儞IoS/ o6^]bU`yQE! *N'jvoÄ́h/ǔ D8k7ߊY'2]^<^;btEurjeQ2& K:ju J÷Qmګ'NqIy&CY8<BurDj=,5wJ/ 8Hvk=J<΋yci~q{#cr޵^Nz5:&-yQ;&~P܌֞OT20s~}[p@E gu\2,cyeO뮯;cP9|اtU6a!.M8ɥ_U:Zp׿3v۔[Zn{+観ۦۥYg`Kv`xB$~HNncSS{@̔;o>AtLK3IUN80߈*/ Ɂ)O1fҠ_] S#8BoR);o,g#]uB1N1'skHvKS{0ƈlv{"TIDDPHd| ~c(R&6=c>\1UV*(s p\懾qyʱšPw"a׶@h-ot܏l`1Fͺblˆ6Ib{#}ˏH),xJ>F N߉tLff?hrz|{>Y4wkla;*~&Yfuqeq?剁s!9s;eb*ιH~U)homϹ)R#B:!xb*#-BF #$@(?ӹu+.[kYn0P@ѐG39R {z`y!fqs xޭ {9k;3#1#«abT@ =ƀ`ޣrͭ2u1ST>8bI߳?4:LJYtT5.PoxLƣاkɛ[[+Jd WC~+wA!bC>cv3F0-`(lE615e&e nRR㌦i||o?sUڮ10-Ӵ*冝b;^U5&ׅx/Ժn+u XaaSCK |TŹ?$'0JT0`Pn &,,$D+j[kA9R7Z)&%A,o jN %"}lC33gfμ>3}^O]P5`#6M]- A7h!=%P-Օ)m"dJ4_c4AGmu7S{\Ӵv1=T6^7ڥl|m\ʶ R뿃jӦ&k} Q2yfj|UUxAfDžȟ nh?T,pEQ-Qg4T|>YW-ʴ>FKA%509`eXwh~: EF+'*'S޳gb3rMi;sbS=$"9z'}󷮃O 'uߤO͝[WC(gBdUg IAO.;/ gRZ~]YJXP߅}vκ h~ 腅TF]*! OGs%,|ƿxgd k=eK@.x=e.וH?" E='Vfw&e)ɿ|1ʿ9m־jbnk7C4[WH3xڸf侙.V>5SN\Gj[έJ<<9Ч_D)'1*j\Aօa -?DwmP„.J,l̽?\#J,С?(* :ۤI>X$o'cjJJf_#N)߇eI vhہQ+U^8|ot_x|dkQ[h"*OWu ~mGPɤRn<2n%?[P{U.=WhF'^Rh *?CmΕň:YH˪.g&m#) f'E5 W7^ӾL_q^y]0OMw6~5oˏ|tCa.߭-._߃|]C4P6o{w3? лWwDe9|t?§]I PKѽFװgK;wv;NyF9~/Փީ_>!&~X7)ݯ?pf9Zް捜7o7oިF;KK=qYy_^tŕE-|7Lzcik [ʧ?͠*fλ},0{^p޼PeռМ)]o'}w=c;(iQo1 >l6w{zlot &?8;4*AڌGL d`en\[Max~?PNֳh/cq>*?sxZ/:.5'xV!YԮѣ._{&]bOCϻ>Z =Z\<SmN%nM@5|e]zLpL18 V9ߠ3bT76nj) wh8h#lg=k)NȷT2f 7 :]ޕO-ad)(&FGӾuKPRW>`#9p*R@ [](S-+ bA htϡ.~Xyv& 䙫Z] &7q΁۬6ܼZgc0?Q yG,\}96.-ǝ avʣq\'0T~:WY2zUgPH&p0hە_7<Qk^Ox+r*}e3a+uHW JWeldbOn"b7}꓀hx!R .QHRj)3 ^{7 bw$}fwYXWSL޽gf\؏ pH^K&eo8'Ҍ81Ds 3,W!Bs6bm`Oһ߲l7 lj^WIh2jɌECXW+p>JJO k9iqd_idNXl?l,\(+ψ4pH𥞦13r-C9ZwىZ2iMI{na'|i|/)WTGqiY b5ʷa@ˑ̋B3c=ǰ8T|4<2+PmyA";5{jY([tT].pP1R(v+؎fOaΕK3},5<:"b߳>4 JxnaהQQ6~Y|aiy{4)[l,G̪)&g* j}Jɻ',d=-yd/fW +=sg 4Fpk]4A-Hu{0*98^c3Deؾ &*ga3*<7~_:{nzQt P j pZi6Hjղ=}a3 -A l#F迁X2/R t=3 0V_JUvJ>O07bR>_1Ee/,4 êy_[cTFW{_.XF 8[ȕ_VX1HJqU(,:mLgUvX)4ՄAb_}Nk?;Nl/m1K e^ĽnR;|Ցin7{;j4ؔ]k k/]q tFZ:[/lgy4V'VU7wMw-Љʒ`wggo ov>3TLDˌDJT9kKOozH덼0Z&sZ-Ι-~0D&m3`72 T_ ӴXvUђwW]bsc19B +s[]eLB$$KutcN("'茎tG#4%Ǵ+1ѢMH+ler̻'fp;[(Vzlr,_aH:8*W-BV6c4cfLyߡQS- &2>u(a!p9DN_CU uB)Ye Է@v|V'p>t_j2)Ԅm@"5 -_]9A,> Ɖ4iTЖ| ѥ.оSLb'|~T,c?A@7wGW.ƼBA@7Fgsnaza+GkN#9zh8RnȨUcr7NSp8n;") ăH3t`.} me̓+v_;wїm}$#҇%2G**\ߢ2XZP W٦^ t8;rqb$9.EwQveUǯA#˃6"KUKahXջsr,r Cre&Ye~Qg#Z~̈rʦj(P&!@RqR> 36|7*DvzmSP 5>9!U- oo{QU9#gQfJBw<,-]@>:f>-cti3XfZ2H8͔q+aGgX 8pM1p}&uHmÇ}|p\&'uSDlǝv?8aՉV"6{Ŏ3%ZiK܌`)kh!?ߢaA^j+EgZ`Ơ^Բf;}-HؤE77꒛4 &:>r8erItH$K< 15+c%ң2Ur +ZQ鄁}'{0/I|*+6!^oUUr\yfqd$_ǎ E|^k{X6oWS`RJ^ZHe^/f5E9T ~'C) H)}\,(7c U'A6bp!L~R%5zQ<.QG5/]8'QqLf`@5+m  mEn8 7νW֟z.gGՉ9@7!ۑj#ғG1I r9 ;TrFb; ;5ӬmZv21S[Vdxwv ͻc(`[lTK@m ~5UMjHhRם@^(Z^a)12G2(56vպInɃG o!+|K}Bm;$vbFs*; M"ޟ)j&kxPMNPU4pi{rN]!v') N]dQB<}itB9ZJĶRLem|g@L#Z +QX16+loNݕ[zȬJfS} w t56v"}Ff̎oFt+ /b~Ef@| S^AkG0?;Xihn+mFX0T)/DkA[;:o=bˈx18X׉2Gwa 愻Lh("5y_蠦EbG]^ϡY|iUyݔBQ ~b@q-"" $/ʄ<^uiP6"7fXMT%BPGcme@TnwCbӞR l %xօ؞ 馃Ck1"f;a.O 'z[Jx}z۞t\Hm^(`!J]]TE*wK:?867p )c$^9g*[eK\h%7yCacs;JjtUF6~k4㺡*jT)wLuS9xd8ä%KVmfZod+}l}\y(i6Ibk#_-?J ewJV#{5+v;U˱FƹA)?6=V]|?vv˜g%iH.jn6kfˊkΆv>,Y"oȂJ.l-G"T$*׭~u)v/1Qb: 4#K g>yCȧ]%c168/yQҚL+*.p;:dj_+?E}n3ĺ7/#jtZ cQG K!\.Zd7Fnԁr5]z,'A<8)ZT<4ǾC/gfMp0bܕGlL9s;riiڣr-8dv~368nbۛ}zqEƌΊ,jS+Fs;/@VuX>T$_ng6,"?!򃐽ODfz6mIlA-DwQrgOK^vQ:{hxs9Z>YsDix;# &qHU9ƚOD?29=DWL"*/WR5+ik&6ρ+>aZ8$zP.%>[iV8elh,˔\_8<"7ަT{ >Up@^<mbG4UJ4MS>DU~jrsQ4G'bKHA4^]9^OR|~%*mq {t\_-uV\FX^-7 mk#M>1m݂Yy үeO }ePt3s7ώɟ>2`5neKO8Š,K $E->}lcG-sKB:"ר>rRb:2Q qS2]wbPsjDo X|hBβ@b8 ?iEPYZvqXF*tqVN:ڋYt n0>،&+n;3BV8%XnwV0u쀦VIּج /fte-Aeh’Z 1#iQ[H[*c&2;G-_*aE[y,kcefۚ"B:tp0a+,eNcxں6kd]ƺ癛E4leg{iMr)l_*஄X Xɮ\?zY-@>CR.by=r[[|DQY+B`Km_ȖmyvJ-GLi DkBwh%ND=NԪ6e&5eNd<_Kk(pFL"2VN/S&ksytQ{or10_]$:6B?9C}5`#΋d UhFDhEҾ3Cһװ?]_646~̆>ZCNrU<[ie7BG[FYoap@9?<,)\xA|+^ Fuw]..F%nXU.\J[ q25B#i .to:L͆y{j;UG̦(]+ \rl= 7_ kdwq}rv\ҖW؀c!Fx>p8 )qލ__nshFGacW2Ϸ(B'y,;3w6?.cjT:@be["ʇ-UӜSn]tBλbY|%w ͺ ~GiwRAp*I>bWg*?YTx,0,7ݢ "Ax()[d:|: 3(owLT(k1U2Hΐ!<ѪP4iT3fl2:*d &Gkx5C-c3(tJ/Vw :pkşa%Wa^3Wn;FI<|`yR9&Q\:Ѿ>R+FCTT0w^d &YC <[1Kam4f&qٰlf6/B;/˓u"++4 )N,RcȢ5A"}<,(ĥOf} JC}[ )1t<畑KO_^ 5].o້de ]MB}^#pjCÄmOOR>ŏcXmpūTt)'FlU7!^+ qC" _0}> ޵;8)QA_"Q 7Q%c8^-fGNt 3*]ѭ*6:Ǯjj܌u; P4*NVBNdCˠW?ޮIG:֕ۚBtY=pya27WTFx$<|9>?l6|Y-? a-W$iIki_ц|.6m ~Oِ/PQjfUٶ_X<(oת)F [4q`7ȈjjmڭGc<)𵥧 Mei{䒷U+c=``8d}632% Ii,']J GPGa9:dEM:Ej%0L)8'!e&vb8̍y3/W/Қ#-mk2JW!\2E9Ѫ7^.a]D;)hU!){WmR4]MS=,V- ARc Ws[k_e擗w.B /Zf\^w~x+Uj|ÛB`V!y\P,EP -T CU#*22`1K@a|.eb5V )h\a>*z|m$.{Hk>Qo7t_a}~[$OC lxL5KWo䋭zc=k=ýՋq"0!cy@SĹ 4BJE>7ђ&yPԭGTuSj(WQaaW(H[BYiS^1< ) p|fgehW I7f!QRp=96XZF ď,kq߰u>6Ac1M_NAdȘJW)b+hBtDsJ՛")fD32wS{UD4Z>;.ԫc˾[mߍ3\ @kۣߢ÷gD]QGmƆcP(|׻M_+zlZ=.RU+pp.amM%֧N+ 2cT|[7!Ż!"/TѺَ2놄^fΐط1d-(.7̸U'[v *[m.}F}rDdbh2zxb>˕7Mjʇ|މXΤ3TYW2EʁwSR[^ 9ȟaӋg+QG(W-/Bz!*tNrlp?qMlwP׈Qvw{ݎ5ifDdZ,Vpp. d;inOHBCdwq:ҚT`O;BWꖖwri'j+N|l6og gc?сp4(r۫؂3U#>DzK _\_e.Rz1'#]j5>Fr6rܣD! G x nE۠> Csh⦋nnVld&%+XF*c^UYֈ|v6 [`ӶiBl̥tJf-W'kV|_#b/V#3Q_P]%G9=u -4IIwa#͏V6'ީI5"iJFx;  ⾚CKh(3#ىOS[&;j1^|4ڙiDx ba m4:W68u8`˱#|7{92+cx;ٰ$]୭\Ǐ}S d~m̄}*ȗ Q }- rYp=g:rp=v%Ζ\\t`L8Qyqw4(}@5k4.bY C;3ߊ"LI޺h,!`s96ߞAV]F{O;+YBCNZ+5Ւ0mA,;gC-*XАLΪȆ,ќhq:h𖞎fF[3QzʁX%E3cP}7~iTԌ#NN+8#PrLg+$QE1G.[CT*(zKh=`BQO<M[g;٥\< nRP\ ΘF7#O~V8GSrC_52@gd@g #F|5,mo)S.xfjFN|J>uľ&)m\%3TXxV梂ˇkp~| gk*/ZDz⬀]Z^*kfSfb\DŽZ k˹a0a,bMJR[DHKHl e{\ϸSѳ~`fs09!L*[NK5[]%NVFW[K! mɾR< q{F(݃t-}fOɯ!xFjk.G_?`ٷJƦjcXp`>LM]ӬWW2JD*FmzO`,#e߼ f|4ޤj&+m>߬7#۟TW.^K!{ >M_8cxfz^[Xh8ceͺȋ^#+|貈ݱd쟇>| &"".$G(Ȩ_A6갭iѢ~}سjP㙠Ӂ9\kR&`}=vܬ<%xJ*x?q[?cYu8Dַ}Ѳ~}+yv4a<LF4M "ڃiۻhLpz. #2_O~:QSOE8`7*v4{i$ց2*z@ K'ĉ^[4GՂ 㻻VqX}!afܨ/$Y+!WG%a=Z},If_4$ 3kNȧِ{Tfr, Oy ߠ.\j*+hXOI L{ۀj]ھ()DlTC:`UwSkOʔZZ|۲2.oš1LtVM> 䜦|ir{=qq%0HɴB;hcAQ8Že*ֈ<|ȏomi﵌ZkLTp˱AeVT0E-)ʱv M6h TUSk5xpP_zC4/0p^q 'G?4޲`.ojjGu7[U{*D_^n!|Ԣ| ͉*4E [ɫn >!) >&>YFmlѳ |j /]om+,k)x~Hm䟫 hO~E_=`*\ykb- y݋] ƒu1 3So  ޥLOj!4"cPSx_s4cw7|60~B9+= +F߲I,P/oƭ-Иo/.j0z30mjoco.$sJ$ 5Nclr*J)EV!iBہ9Gp!s}n8*#a#!a>]a?LVE<he]ͧډH0 n/Sɖ7dਪQfOڳ<6/F@ 23DAf>j-K,s]AW#ѾMڷxwiH>_BW9o롳/.8v2 >s< {s]|yq_^~/?y/<Ǘמ |ʗu?_]ɗKr8—#U|9^|9Qϗ^/};qIpby& LӗSbTmFsu vNҿ>ڬ[6[֠隟9 [w[_jXjFmd Q[[0N1-9+nHyYi\J9{V=̿'79r*ncך[fsοw%f}ly|-i_|.]^61ʡ(ĩϢy9dG&%N.kq%_&n*]uu'-'l$cn/du8]WaяwrVPOGM6L=uۗ{,FX0Vvnk_ňh|g;j[Wng)p~nMyR,2gD*dVֱ8i,wzoK֠,Tn=|p>36G9 & %qƷkvnh [طK*XMܯKDܮD_UrP]5EY.XO[(H=@x Z G_Fpײ.m=Tb˟X!DQq ZP q& xCDi|Co]'RY5B=$;2Xԡ#1XC)=VwM(wA`GKDEQ`~l^Q@&9U2)Jʤ;%}a;N;Uk]#ur'Y[hs<?+]Yʳ ~m'lʄ6FCE:Ep ?3J؅ڲX&'g]*{(ؿ\o.qwVy--P |eJwɫ艘Y.ŧ{8wصTaʲD.kZ*(|pR yK{@50 XҿR? W*q O:e'6 ޺c轻"JW\jZ8WXTU}XbS[qoR/ʟsXFeي?M8;}1+mu}i-VTkeg@wة56KuSejsV?<Իof@5*XH;K%֡8f9`e~GoWr`0LI ݓZ x{Y;P0]wȷU qŊ5͵#2Kێ?Z!"i}3O/mEE)lլ׉T'nWG$hE8F 4Rj! ,V{#쨉24nN8trFԮ+Y궜@m .wtiy_#q }|Owƙ"iȖ5ff6{|HmV'*Vӈӈy&]fwðq%D=}?7׌M':<֊)"8.nnٹ騕-i NYyV.y~F|Q*.[CIJy)+3!FҗeLQgW  ~l}F+jYluK֤-XR |0O곛/Rz)Al6,P1Ee?NJmY9I/:"[w/M0 k8kMs8&;;9=3]0s#{L,3VDDE1CFw3}m'$65@r.7:Ss Z~P2 j4ozFĝV؜́33n3xD@8kF "ak5a֜8ޜAtϒaȩf0mF,V^NIyk c7~;|-R+/W}eURѱQ}Vt-,_>-RD<%❒0/ ~@G*@|dPΫ"chPgJ^njt15ߦЀ!Y8h(~sm{Y~XM|E,}a+mt\}\o[;)?j#`3x՞"V;?cw8JW`ߤ`wr&Q1);)x<9)3Xqe{&t9)gXN M wCd=8?F4zD,5.z&==wAϬ5nwpjdGszFzGO>8]@?giYO={{ž]׋CILLt>B/Uo~#fib/Δ(ddY m'GK:/hcBBko.h6e37[8l>yN;DE(R-39 jvIpv}b1+_..EsũDĩ컮S/Dיf=I+|{!z~0pTj cqV,(muQssm)+(;x#Km1thryg>`3x<33xP䷮GԌ'OjHMjSGDEd%+Kvۇ0d'硊TR'ŲQD}^Z.ّklj9n,9@+T1|)NĚsC<׉2IWy32lm6Wf|9b6/Ʃ+2d[V˂ %J vxNEΉ[Hؘvt#>' 9LpC;i S8v~?;̌>B# )'~ρ0||$Iܿiqڞ`a}) zl O \Ɠ(zUVH'U7W1!&bcNas Št ֧Dc|LSF&*FBTTq }+lcpbbT:U/N$hSL[63 .#^eT] hc,Uشu4f'*l@uÄP-5]ͦY؉gz7 :X@U!9i'^wIp"r[eG(,}% [Я]ඈMQn)x10 Jobgf Q8BV$E;6+M{s8HX;VEQM[UPuM$ DכT! A.44\U'oӑ8{$9R-M$'_=VjŜAD>벽 WUa``>L7".Q5$:溋ů P+ݏt\}!Mӡ#BfFYGf'-Yf%bʄ(DCLH>8R@!EdB )Bgԩh`S \bV_`9 3xWlljk^&0CL^Er8cý+Bv2@ 1EM>ϴeזwLg͛,9Zb>}HAsͲ,+ģ/ڮUݔxաPGym(Az3ȓZ"TasB)qbm=LCa4*zanRa-vRFa Ub@@E 9®QaK8ZSDžfG󟥏y7C|&D“s(n -;j+LuIކ[9+D!FeSoPgcpƞ+W[jCh/ү#yD-:Z<sEn Ycz^ t3n)·L!|(Nĝ8^ 'q]R*񵄇[< JY_BFC{]&Hј'(YJu<8ykY̊˹`Rٻb,ԬElX=sΜIC,nhH !Y˜!bW6)?jّ (<-Pp鱊X>!n l!u6A/m,irEXE a("Ǜ쬸 p-טϹȟ9Lylpv:BHvrNb}σS,ѱnHXDp[1>;mDpsuD>du?C%›?1n&wN75&T4v68|jmYnӴ&(Xj@[Bv*Yx/%,%:76snn:Zm@ ~᪂sO 2+z&-~8y9yq|oL4@䙙7xk22䵮ń }B'΢kcÞ ~70.8P`EڟF"0Llc7 #<|6"6-4Um䚾Ľ&e5rlVGH4:9b2Ō`cpL"j7PU:7,@#Ǐ iJˢlꭝ@qsSKڙBPe^;kGu=9%AMk罐{ΞgrmLӉGI)!A`>Ov^w]1Y<|`EV-c 8^Z^@-9jvI2-iOLn,1g [;`0/0M”}ZЊ ggV EPLb3]#6Dj )w)_ebe&c}%Y"Z;/|ՉL;X͇0q[gj|H&WΗ:u͠]:&7R!B%ǘueպ40Ҵ[%6&5>h&1O%,ȭ*(F9}Lg4˭rP1'YI9ey8ጜr' rljC5-Ff`1%}̒lrmZnRO& cbV%)k'.8W ;> Q(Z& M);jV,MeӸ=`݈RϞQ3yՓ'VTU#^)45cik;@XK4L-:`NL}@vKtW6:'f+նGR.T%yN9ra¢Mݼv2t41Qs0Cubȋ==B^G*yM֦ү'yLv=$!yn̒5eK S. %>nT7!6rAfR, UA)U{vqRWD k@}0R 5b}\/Bȼ[XWAd$`潒QI3lN_UJ?ִfi昁A{RVGT]~]fv*I/?߰{x%@2D#B1Z֕u@kC<|DKmέ kr$]v1,ծ>Nn1X$GJ{yyJnAd#*  q1P3w\$L{S.zSߞZ78YωH] lA22ըY`|X; a='W;sW#򳿥Ugo ^B@1X)[mٚsuGrH.14oR6,7K7VѤB8p\NV;q04 CgP ڟNJ !X" wtx;*lu݂Ĥ˜iئFG)4#'7k? )&AθPԜԉua';z7 Ch/} tfT8Gl. NJwiu{s뭷oːD=.޾- $[).suHWc!]0d;{l,$(9T, !3 <ĖcHĿFCkVm؅KzNj ${DR&irwX.v'gr:ɥ].1$ay =,dD`vNXyĭT߱djA0'.˴٨_=YwE' ] fHd{ɬIJb){#k46!֋뭝6XQo&Jb8m6CjYcq@"unX7t$艼FNf>5) l@aau_#dZ)佘@}-'z=~R=KMx-C?>-JGR8}47u)ދ 2 g6tBUO6ƯC]ʩ?Np7lTI1H"h&@@8o&g6v>s+ L]gCf`]+J].뮛垛9Re L*2kS|4,}bͩBYPR'{ۻ׸WgZ;0|~cq:BFCR--ruGM%7x( fDKo͉hjϱDe\[Abn]H: υ,usՅgs0^@'Cup)zv׉W؟ZP'6³tɣ#9H<֜@<2W%_T$ $U =YuX" <3)D{~Ɠ&6 ١$xl;WءVkVn8>WJ`*u^24ĸmyDrz5j>mvބNoP!N\m"65]unsuF+^F Ga ڌŒӠDp.sT}'?wm_\͔ϵ=mr{m}ۯz>uMK<*DZ%$e]*2zفl(߁rRݹhza&uJB[|MkUS]C=a%>Ǖ9s֥>aa H^|*h%Hc \ F$<%Mbф_7bTNC,~F/1HȲc'׸SW}@t6=؊/Z+aH&vcr,L3@*ژ[/Ang ntB%@Pw,"lu?{zݨnllMZvKz§ٖ4|j-K~>Uі>U15|j ]anDShTi&[J}hZu'lŷ!ͬ-dM08]bk!:@p:!@XODRݿ-*eٚ BvYϭu9!X$((~|91&K@0^i~\=lK&;hT5G?L`2B?gg* wgei83^61_hUؿ_XsDEٶ"L{Uc!ge:=\l~vhsnÈWղ^v/ݞ.]dw0n<1B< g3eQMJv6E3\E) RE .xkVGҌw W%;{5X º ykwZXJ)HOGXJ]=K#Tv_t ݍ`:.9S*TWpq|~2ub|#==1VM[V'Gf_Gת AFIqJEBh\fZh~7 4*!/3$P֫lcvk/P w]@xo*z?=Cd%GkHbJS"޴ɓ6r~`FPN:o< 7aoqCAURX ݜETmCv϶^eeA~O oIJZ\}d"xDސ "/x 0LI"1c $>^\dh8%MCU5*^~`R&ZNS#٫xr |zqj8^,/wpBv mRᮣG}>X7@rWM.>k~WU*~X|(ƹ=g_ Az?0_''O\#o2oU~%|%jLƷ#֖\k'm8\6ꝒmssW>p+ t曧60| {2t]61€2za2(l11 [hwҬtPWnOV$ Ϩ+7O(&\= =o7vqv+G`À$@1i@)ݜlBSe3_!ٗ5.2dev>L-"#?V>գc%ⷜoWx>QK%#daȸ`:OJg_[@q1=_H:YTiRJ{gxN)s er p^gOC\\9z_:gɡU˞$-a; F/qtbT)wVc^H8, X5ov~!%p3MISŝq&>n+btP1meGHZ =ns ZS( |ӣ9 t%@7t HM2V_'h[LZ=q$e4M>,ŪnΎ[="兇5k*~>>`> !ᣐi5aAs5x[i=Ia'TڀŚ=y) +ci A2PF~moh~soxfP8Rsj,I~A!s@ ,JH~jݩ̟{u[ʫ6شSv8'BǛm,?C9~&@b]Wy7(!dw(<'y:T l 6$ Y 2.YaKb=y(0BϮ>mɤa^{@*eRJ* ,%UL=JwY&:lYݐl<,sb7IcI|$Uh[mhj4r'|u<7j ^Vi>s`QdSfW p:6Ӵ3}L&4n_$8غsAq-.8%n(nͣO짟T;3=8POH,jEP5`d ]N,ь=YB&sh1Wcl-]_ Rr6F XzƲ[muM[Wpf!!K`rr=dD.IN i=eUG 眛P)u@E4BP.O~|ы)7ڿ7s;crܨϘ5"F.Ê+CLhʥwHBniq}ne(H{ ט`.y|1z|u~y? t2</URݰ Ǻ`wnu(tHFCtXLmL_fW[WNAQ[տ28b`* [A<.wr Ttk:jzw9yV[@[;PugY0N$78ܲ;{C:ډs^-qmҸo W^(]BΡZ1}PaVuK鳃:VtCne>yvwcnGFo_iu=4TŻ&wD[vZpk͍$o4qTV*>,'IAs.QQ-Hܸۆ 6PqPQ5*NV K߆&^I,I"<:gD'}oJoYZ}x x~;Z]7coBsU+7xZu}]n77ףwF#GϳՀ iYPn󜑎r5z7;|-@)uрrNc2.?wUBz/i؀f3ɵ˭ qz?5ϴt:&_@%X.¤:ץXn=p/>K#C@Մt^A"Ch9u? Pa]mnx Tĕ{Zmw Po[Dbш^류~~kVR^@q?ymDM4q%tͶA^q\NZ%y3?RyImMG}Yk/cCi1f 01iaWX 8$[=th J: Ҽ8ð*yfٹXٚʝ7G`!\)"k{gl( |⫨5ȏhBHaz]pkOZ}9{ѓmG͸q1"v![M5VȢS2-=Pkա:m0ϬJ=hs 8z%JH.GZ`V%rZ(rc_\Kt@3:^l2 ;)A,buSZ> @V ,lO ;P> V>BE< \|?sS`À\kAYxwߗs~,Lj yy$\_MAPm^Er(x EB9~T(z†/S>x*u'jD`HH`.<%db2:#D2[v(" lbV<ў6 >bw뀜+cdˤ4[wGQ |^B_n,>W89ƞ"bKrFBWb2w[L]jޠFz>lmyL.՚1/H(mZ`ummlI`eUb`ǥYb1=6nBiFG]ؤJA͑^I6 4KʋğY˒h.Hʌl[ʼn}xm{KEzs䜐)9k-um:4q-kJiƦ1iV6f$'wMa䢧3r[C;h*,_b,˄B'sN ȤaQ'w5V+@wǼ~ԢZU38BE2ẖO6.r}\\B/W%r}\_Kg_!b!6Uɹ~8@!/̘ ی8,*^,1៯ ϡ2`/dP.[;eyqՎBJ^ Yttrqr,㍕˂fFD:_'Yb$̀@Oח&$Zyш"U.(4HTb/^QW-@ LN1ꎻ,fQa~qJԛ{}wJE0w΃ManAECvkeW1p Pg[Qps,o :_|MR:/&BkBh|vh>*~mD6lB6/x 0=rJQ9`R_*$6Yi, l`;D* F*͓;Ձ4CTE&[NDJI ?I x>g_uH!e:`ZKiϱif[ök%D$@AeH,evWVgUrDj6iE);i)i\ɫh.3`p59ǣaAwLcpanѷE*nn+2^u@}>5@Z'/AeePFMgP⼞?BIC&[T s>TZ*ر|6*#4~6Te] fS`(kD P;;CibsN(acwLh"M KM/&:I٪4#> :`MQ\gl%;=] Uㄾ *1]=mfcM6Ob3je `,1&ioĎ웟JVŹ%c'"yE;O`='ߜLTۂ%it 'ڲS%۟ [磱csZ3 ൒ŀjc%Y^ gK~ayO9壌R(U6!)y'I1\/!~2N*aW2Q&IaHJ6)v556e$sWXۨhAԙ#㢵{:3ZQ`J.*W .N@C+5CPs* ̴OLE蘹JR}YPPP3,mvml]c!MBQtl2:XtlE֝.`ʐG;u!2x"4P+y鱕G+ .*im^$x3ڳ5O}SL˶m{En es@3Γ\\kQI.dJWL^I[4 M$Έh:|(i~U81]%W`ܣy(}o6m~/M뎝]<} rq:JRQ='q8ȴW62ٕ?# ;l=@ MGrā~nW!2Wo#oA[EGYkЫ>^?"H#JG'Bj%uPH26YC%3=ݙ"{7(6yٞj{np1BF?hI LCM>i3,D+xR݆l8m>r8x_?dK&O_v̷=1y-f쀗~ 9Mb22[u,.oh+(aVj0_]OGƅI20-0ۑBi4^*Zd% ?ȋ]p^Z@iR^g|A/UTSDf4ZK<><(@;Isܶhs} yD4XO Vg]:lϡ#ҼV|yw|pk L+b <ԍaO8 3̺Dbq0Oa}|l*if9 rw ֚ʄb(>5ED'~~5/o-P[rq:O OUmevqbEAJcrKZ []KWHeC1?w0_r jn Dn)VB%9 .;lrKy߽^/rKܲE/&Cz_YtF?˒s6:O!h0{8[mcKzKz[ق ZvVvIT eD,x^L6+$^Bʖ"3(e A.d$Z7zЗ9؉[:;hd,rOVTY)+-[-fo8XĢBfI/>W2b693o Xy5eMP荚H[YNc _IkȆ.!f@,"3x9RTyyHB-t^ҁmFwN&Hu*D.= tQTtN0U9B#1bN}lQTA_6ٓFdɹcH5EwFҟdDhNpF*z4_я4r4fbA_ݯi"-'^R<+|"3x=h7 O&_dBNw 9/|@~e$A.Vhn>mNwGMF4+_U˫Ko("z٦5U-+ g;~YS`-:Aq8zP=kR+5{("z, ZDZp|&uaYAi%/Eigh@8 5 z=4d[+>.VWh[N-t S_l Ȯo9>iԩ_C5 eBJckN)UfSh܄RXMՎ;.UZݧ i=srwEG+VY`EɅ*4#Hm᧣y۶騘(=9zJ :+$@UhCv%t$pԮ:ޜ=8e} -J"%ɯ&yLPo8wQGc+캯8WGh{kw$ FbprU3_jޯ;Ghu+S_L _1DKՄw6!uMISNͨY/szqJ.|ц`6&=3_ &As@^yQC ūs 鐙q:CG 9WyC Z/I2>I YQ ژTǦ:yV3j<՘LgzDK3|EzJ_W.Uڣ:Uq޳*Ub<:pVS_׺CZ;˗o+* a><\V&T-)r‰CJ=#Fҫj cK2 f .+H/n[;ђ<2#::O^"P2N:I$_!ɘ=8g]>Sԙ䢜2Nv(M+bXpGc( `k~4gI2MQt عV g0{G 9XI<-jzTsT?v?eňKtHv ]K6f25-qi`V09ۤA}V<\Cw~~4,~%5 *G-.MVnИJsZMJ2Tj*q\}3[W7 ;ƻFvG#uMvC! \E +Tv_u[cxq3?F7dף1^OOP@52e^>"MVD=gQMJCqo}'9S:>Tug)XZ' mEG z2y PUY,q7M>iҰ=--uX6[df&$YG㮅gVGг7M(4ElyJsb!:~Fx2u 9Q"1OPAK2)uTXZ~sx{ nl*$=J x@]7Y ek^!M?`a7B/~\O\ŅRAP)o6+mJEqls̚PmèHny08{txCגPq^c*HY#LLR ǘmfePskNܠ7"&jh96"nL*[ڤvQiⲇMzͅP˜ZǻAmգ&5&͏NFdNudd) ,!NA~/>lR"&. q35/(M̾Umq(xX0x 6IC]Ћ"PDЀWrF{p&n+3#;Lvz.4irx1/gwO 2'hƟi'l8D?ceϏlZz*6ZoOKohiz_-Q6J I4~ ;Y1B&7)F/1p?)4;JZbWR g#BVVD+ŐC'rse%S3; \cḒ)u  e !E  bv?q]1_Ysk7ό5`ZLē{!W2n#HȅeXDԀ=WEL TTgv5b`Ϲ 4~B0 t%_.d1+,-O2A+lК%`'tQA0> J\IJ#ڊ̱]/W .D5D iCp$CCAn)W֥e|%PaGgS%Y =pa-X$(-viRJ_08-CM PV"auMBlo=]+"! #ۺHGN42_wvu\j>ŸOm*G/TO"1d5-r MViF5 1QODr wxn{vMZ&|֏ Ir-d7(} "CmbZDq[X۶D:Yl`n9tqUƓ{b3-nNXv }E5h*:>Ż), 8 1.:AVU}`ύ1ހNӋ%OM2lj[/|i %{A}^1+PPSII'PG|w>Fx)coltaf5>!ъutPvч <эN;WO ]y7pL[(zpQbnwTok6;0bPK=tvDV8uM gG TvZ4+w[Ps'8k6.hExDю+EsӕyJ~||f%f2yDMGzr-EŃ7*K-̓Dփ]o-{ 6"A Fi;>+ӕ+;F~tS9(7\E)?HԢ}4cČ+ EZ1^+bs h$#b  0mq ؂RrcEr t[ PNJd=H[{5A1cQ_wk̦* օ~)桥Olxzٵh"٥Sz&f1M8bLR?t>@zu,\?3C?3ί@DL`pZ.iLMˏ% b#51x*9$e&jK<Ƨ)NlQ%|}8jt \]1ĵfkL\wYG 7K~q)XJl2XJLjJt"g1' V,7z)tv"".֮Øչ4[,QZGӂ8DK` 7ežѾ/<5"dQR<毶+%2=Q[M+U^s' XUT$%vz 4کEGx./+]LՎ4,tRJ$7w`T%K+%oKDR8pw޻jʣuhGQ|\1~)%Qزư}-DKg|:è+0ZZC?!(2 =~9.'E236)k벟:JzRL ' Oۇ۷A%G%^;*W*YPۗO3$r ''hwBWԖmK>O#{I l n'2<D?'i|NҤٛx_sX0-lgGr,!&lڔ88*"N(VYt֏貳/۲з:Wb!i3"&t8gc5vm(zlS3h撱ve^.K<,,S3/nD| I\ڔ"lcpQjDz6R#3V$r ("=bř jSKw&j7#=e۳*]9m3|m{_m>YIU7wԴ=:R;It®Qsq Ѐ %|<;1g['_ǙUV%;ޛQ)3X-0jL FL 4bFL3|_8HFhj_ y9{D$՛h*@NEvx-JHVB`< F"m Z<=bS 5jibBV0E8Y*^`:klUu闡ц[0,)ŹSqĹ whʠ[iAԨ[O)WHMxR.?<N:ߕA6srГXP>IN#T>Dp&`:Ҁ5$(%,Ul|Mu|:ĮՔPBn&%է@,*En{FcZ!L6'b0~¦-h6a3j7x-fUl1"e1%$R+@A C?m~ɇ6uo2R1t\x!R#v{7ƔBF0cAHr~] ^VO 1w@KϡHfjʐZ:z;(}Y_]+kq qbX5:|DWOOKw^)`H(oZtMA˦ 6tg;A-j1*܉\zec.nY-dbNy|#_8Sih-',Qt] 'G"!-vB_a!{Ym5Olzohڢ&?hj~->0ZhK$|˺:~5Y:dl9 iɼM56n.B/+&3#Lor X$^@H@bRa]*k06̜ƣ#[ɜ#bLSgi>>[/,:Z.jrZ} aG;pH+m,M1nᮎסQfP i Bt$!IĐHJּ\N( q" &(G%h1ӳThM1\]Kt3 Io!O1`;}'0 :?pe+v-+rࡊXH¾=6ǒΟa4﯁RmPfAd)9L/F'Ji XY_R<cE9" .K?S^2 Vjc&4ulk!^gH,h . ^94v|^+|Gؠ h:8?49AP;kXgb 93Eeauve9S09zqLB",40"|2v#у@k]L.(T\uoŸPb vRl^xIy8%)PgwUNzW3_р("PEhG{\_u %S-A\Ru %U,4Ab-5[3-MWn27[>tdnyM"qݙXsNomCQ;&3;0+ 䲰0sk[ kCw>s Pr8 +i[nV@%>@j+MSON'[iM0ՕxE |ڀuf_% iUy":) EkLSep%vxA7:TNja{5qP]wIPu.Dy񳕊gYdk٫Дz%Rht4B@gf$f@JCY2 G1A47gssMs|"\s)ᚃ>l\m9³@zWo+gA=YJn,EJh*951@b\bT4s`a20,%mc}/C`[$yclb#Rv-*"qb%`Q N wLIZf`JH~#k2~l % B=*b줆A2AcNZ]-ǭ⨋?v"b+hO݊ xNi}Yl= e7Yn*ԯaXZVVm0j!h, ڃwhvaTegAgyBbb$#Lݶ,5?A$/cL_9_-#%=/aE Ĝ37BPhX6XD,gtc@&Pg~b]xǽqYL086[ 9lk@a 8mŃ6KQ+^֚"Q Y) 1b9;#y TiKų`GP'F5`UMU\yz:d!Hc!¢fbn|}v4462Qh$ӳ=weMLqfZ@v=C:(QjT]!4b(0we{VY&y2$s4ğDܫq; ·ME#QV(ՏFm&6{_'jeY l݂(2QF(fjek\L A Q"^%='pw  u>bƒ0?n$bۀB&xl 0'~?p$Z,\y䑿K?J~jCϦKK0JoKK[{#]Z.jqmy߽Z/"Q i=i|bͷWKavձvkHrBΎ%ՖZ;Ume}%^B<%VeIIl[[Ȣs- {aQq!5 u2t ,H)?K?+syFQu0>;rކT >vzPL!q678Al i录r^aElAþv;ʩw¼Wt<B[UR>Vi1Ct+;X"QWBᐦ;?IX`ybb-xVT`h3+~d xpx IJƔ p)@1jgeodx 4#+kEMaUjhH=,[,,Vtd"@Rt#H3D.#^V=k^ R2Hq a_\Hy^qL뻔{r]SOhaMB&o06wR|م0&Ƴ͙SqLzYݧ4h42 Yw)J vc-k/)J=~+߰hB-mKW6]br'j%Nse,c_sk'j,[/h[]SN9`I`wgu{YzyCC!MҎ\ J)"BGpm=c+Uhe) hdj#-ZsVEYQӢ=]Nm,k> Y6%fskӜ#pAqX#Χzfv) HJU+-#0 SAPP|r5?tz"*P3 XVgI J3|!^k$:jhǽ1*4zwva";r@@KEsR2;RS>bU'5م8{06OtZPwBK}/j@\ߺ,9&ʜ9'-H>dWVfM.=䂊_z6\ܚsCz$]vt]T;:t(ke;֪:Jzr $8r &CD[/hy?P Y?<=MX!bžǚ]ۡ/?S=quB@YPfG ^h:'g%NK&N&dN) LjWvFs{D'Vܵޭ;W9 톕(SSX Xz`9qqwq42ƥPree%(3^M 1Wl:32=4(. *|Nb#2.:#*gE߻Ŋ5D`pcݗuorv؛eGg]Q-b+{Hـ>&d3筟MIc٘U9ؽ0 ^;ҞZI i~5K0Mlu).u `yfٙVQ#I`GYLdM fRdJ*ӯc~=/CjY^`aB|~S3mၾr7^dn!&{>Kb/WG e>>~|CNj&o4CuVE{FXpR6;>AIz}R _W̊!`@{AaJѼAZdLǂw ԰~ ̷~7 %Q+ L}6k8`c"su%ۆ0^|r+ ev|5QmVU+|Y4P;h"vOPuvx,ʖEhFv'=NBOnDulExD~{Ʒÿf&rP]NM-@P-V3uA72ERUWzB.\-ZVKcPJɍw)\(>{ւ;ZCu?bE f( ghaàp|GRq\DmHk_%hώ{yus؈Dp$1b?\o^?YuOOQZ(ϝ>YAgfIzwK3ߟf_7=%t<:C׀W T(y)HLh"a9>J\yǢ+e':`V:Jxcj9,lğJIǓ9 X<1Cxsٽo*cݶآ\jJ:,0#(R(?c``=}tuE1ߢqTyrȏ@`#PU4sT)Ľ]N(#DD-о~O 9*ubP,4KeA\gJߎwo3XN$[m!f^tƹAke{OB>Xdm%؉xb&DXX@a| *mڙȥq̝V,g6۝]3`8fKoU?A:+fVxHҍݔ5ky>zφr3!M|7ȕ~&}~jɇ^\ {{f,!CV'H{)hArKkOUґ_1J5|;Ʈcq=un+8)gp@ejPq6s#0Rz#< ?Ȍn JN]KhycBGbT T3Y.{HFaz-n<딦Ҩ*83Ԕ aVsWsN! uNJm3r;C֋s%J3;2O$(('EE,ׯbCSa LEA34 x㌱UK?[تv/pd9iM49/?2TcE*4ƣOcjʴ zC`A?:ExxaME&s/KdA 9$Gax;}>@"a,S<`Sۜ}}!p7.,%t4e+lWbǒ7]avԺ!Y o.!tN6AEﵱ#|?-׆|U赳0?EˆB)Z5޳ʲ _Dk@/ϟ}7$CWNIJԛZήWpPC ﻰR-Pm%h4/FkK+M’Q^ҋ[ޥf#f`?&lT;YB[IE|C-5Fgmn[SfI-_X߲xˠG[ܥQYCfBlx f>ӚK7* 7zݷf2^H{Hc&pGu놪5ʌ*Z2gDn[Jn'fS7h1chAAShVUψZ]JK%{0ϾbxMa> S@tX-_K?+ !)m%T\􀒘6+erOH\o~8AJa a^[Gg*0%>jH'|L΅=󩞜ϵK.2n4QͣQ .{{z$uuoNŪІtlDHԲ2 `KgQ3s(x|mŁ"½N{|,@z\k׮5p(OR{Xa?`B+o"cFRw7K[C?1ONqxX+‹ _Uz!fQj~2Ոwi~w9eK pz%#G%ÌQGva8LAw]ui[3hDcF&[zj\j;PfvJ/Wa]4V49Xњ9i%4AE]- 1 EwJ7\AʿwS=kvWV'AÓ%Ju@(8\" 8kr#EFԁE e #Yy%^%g7eTvWʎ6ƀ+W@nn YFѳ};nݦyeǽf1|3T 6ۆYfruů-Ļd60G1^K)7Ұ8BrG@7647$mZ#p3#xz6s, ܙϒr) y 6x46M\D]E|GJ#LZuDBpLNRPd!51{ASO"y~p܁8>]exv{Y fǚN'm1M XTGDZYE.hrJꏋOw9Sa 90C7Aa]r,0@wwJ{#ߓ`T~(t)~t߮ڽuhwK^r}zǛpW͚6KVg2mM.u>]-N$Rw'Eh!lfd0p%% cY~S萾p#C,B+UV#Zk(F#9s"æPZ̝@ZҌ^+EI*P⫄եŖtl H[%E*x%MRZdܐ( @!|D0n]| k();G@ͼ7=nQ@ƫ 0:]049G !*RJ!XtV>W99#͑x?L #BunnB;0فll_Gc+ʩ풥eb$FlōG>7ǍN?ѝNoXMvzNg#NSCzݝiiDǑZ҈.enCPI HD`s4`_C۫-Oar"Q0$h?*R O_5Y f i`,s' 0oᕍnbhg< Hl1 ?QdgWK T}R9 fW)K@7S̱_5ꕥv wj6j[4D?8TT\{:oO:=ѓSOxy)tyfi<;4cL o`^&J1'ֹe㽭|$7OE#c(t c'A  Wjy5}m'_7jKFQ:_v <);EXG@vЭE~߿ڪ/ bF"z14![GE&Bwh8tJJSBrG{{9q5bBWF -zQ+~$9!mk4! r"fK`R{m^T>S%QksVNL&4,ipB-O,Za( 0`]> H[\eL"H/JiW/5n EBՊ}+t ˞-aKL2Vc$cLj|_Ƃ"w7tk-dmRN"z-! 'rGuDTΫB 9pA‚uL#=' }PKFORjŷZTO(5I""B]&S@rTGKֻGV-g.nv~:KZ{,#{wiJ8]ګ :=,Lr7.`ߖ]'*X}#bSm]|hZV0.42Xe9ȭTN(i d&"z".iž/ZR*!QxKr`]qd"ƽhbl5- e$*J81GEا俀 F> n*:ID)0%x]g$^AjA{U&||p|Ogs:g%W>@:~,A9#B>%G!%R} *E޽МZQ~c$~hx'%zG14N?Oqbr 8}ef@) (յ'+cK&sMvȋnEB734DiU3iTZ6Dĵ$IFDcIF\ I&v\kbGЭL5r(/fjo M= '݁5kt7x٬lR]Cp%"k$|#Oo[ϼH'eFK $lE琨d~yIq(蚇AnlYcY'c:QWe)t<g A+YrKmݾ/ƲB_nQfe9 :+SYFP{E*s+\:z}QEhNMTI`O$'ƀ`@-MH'%~7NfɗN )"ڹ3oΠKgK|X1Yn01tx_HhCj (CɦmE0٭(m_F2I'a:lG[z; |$7ڟ~e"3x_[ $)3p7U-C||X׍;^w٭Lo57\ܰøM<%xLY#uux隼DjIqSttU1~#ai4Ԁgx=E oLMt%43qN?ΘЍpF0} ޝc)v4 u!qV.1Loy͉uز.<5|?4s0jp >A"j F3P^B>0j/aB7k { Wy(zކ= wC{l@|ܞ_Zp$hQ%cQez\vN˒}L΂a=O`V{~BSʆ_0T8X7`ڐJy9er (H|2Qqo ΋F ?Q萬stZP1&<ouY򡎡T_sѓq,}xe #8Z{Xz(EvlrF[ĊќZp媂x܂Ju.uh*Kd q+`h{}ҽtR/ʽ@J&7bPrAM=8gkxxVĬX1Wf{X?}F*%\yxF0)cp]?kA˸~+~O5c"M'd v`$l9F6/MXBxf7Xt a51jnLޱj1~7`ChNޜ>oZ ~.N[~<;$^T- 'V{ڨf #p וjj:x z_fPAG(G0'?BcNĨԏ3(nkBީvaMҷSw _ӊcwOqDp'gA~?}>7sѡ_ %-FMF_&GË7K]7Cm6 n^/GZ( ͆ PBtBk٪5:/0v.CtGoS~j*7v>*fXwgKԭ>@2+*U4<*/F+# a*,&W~"']m3"z6Z NY'a(6,x4+#9;Љ r<.y=Ms:M p7>ahuS&9UA8 DQc:2֚dN8.Q#z}u>1<׉ҔdF ~#GX#/O0o-4rm೴f[% 9S\YДĴ#bERO?[&i?qhj? =J͡fCi]IŠy)te9ϰdkA[Nڌ6~a^F6&!~50#Q+|qvIr尃ICK |Tյ?>$d`&h QQРE ʄQ N!t:^j N9֪Uk[kX)& PQbmtbQ}f2ǽ9{~ZkGîLG҈+az DwYQ+ )RTP94uk귋;`K# JV|/i]v3EܜkA͹eh}426ǖ7 n]6N{klpamEuEmj{ӿuh\L=*,<(w`/ IߔuDY[ڑ^T.Rε_y)Wqbfq,>(&*)AR6/iԠROXo_tq[^ӝ]*Q@TTjLϩkq UK$uw$QFH=ng>+@<\YWzyO9ǧL)9'NX)9BpBYA uV<8 ֣)|$}nogymbOʉr$$_Z;Ųw839(3evK6Fgs?)#N,R$I~$Qk/LXj8y74AmLz) ClAѓƗ72e lpK)`K|WN,`9` >V-J?c clLJuNgz!a c`'уT^ƫ>e|oy$4NqsF<36amMzP 32HGs|'=4t%^iBm39>1xGqѝУ jdJ_;_<d|4bae` uKX(1ZN$7w< C!sbGj) k/B`,N# BQ+WC,AsḰلή'LGO=%tKEMO6YNNISy՛ {iG!pF>SJz Dg jqz@Mo(PkJ`y%-K1_UC'obk 2;D e!ki2~mojJ]Vv++Q0iPӳԜp1eI$aәNgQ,ghi"OJW Ӑv4!_eLriq53OtBhx[q*Ok'̥N\V hߧLEn3pdTg7Ƒ؝1+|QTFNoT Q+5 eŦFV 6*}/(9;۸Mߙi-G:=t m {,Kr]"ՍPӦi8G`c M|[0__O𵉯ڱﺌP.7OI.mO#bb+1|2,Gw&:{B#3cu%/BŐf6J@y,;(-%eh44\W[8g+ ZQ#x;(MC*b4TʥH9(iu;Kt@{Aa3RF kKkQW縺t. ҉¹4o[:2j~s-'NxV:Vh='?V#U" 'pvȻ iUsISIIW$],*;',K(eˌ/kYfTL ̐6*}l{ Ay*[F ĊV\EcԔ}-]5/fL}Жcͮ2KRe,+\**]Z;J.N~Nz, >cSMr( ֬n^PkyҜON ?S?_O'ea_*5hu*sQ@+;ZEs r]3k4.E[;ed}3YQR7[BӬ4ݕnَhHRPPǿ>?i;x^Ejtܽvid^ $4xT4ĹQh.iF̅ [:[]krWk5e5sT[4ho{Ðx~*}ojxF⾆ y TfY6nvx4D3w=*NK}ydByʐR5zk<{W_?ūyP<{Uoa.fǏX ֢jyj x [M hCŌ$_K/ƯsuCw+z3uk屺g,@+WM#NօG<û Q=rDʴvN$d\>w?R*'?`⠳H"X+Y>9} ޿Ӓݫ᠃H O;ĸ5iq(Mu)>eۈI_2I0gB߸2QvM<_YBm,9|!%[grЗoYVVpĠe5(\1Ԅ]x 5Q i)^;%q'$}\LxFa=aF1Ol(  Z)DGu{ٹO`!!١ZxԆZ?͎^ 702U -XUbPU>PT\/2L6Q2A ks㰍aK*zKCR߆d>wx?>7fJq z/^Ӽ\ WwEBrQ㙩:{t0藠f4~#'<@xwJ=Ax0z*g ыh][zE\w@[wG&0˜w+' 1߲n65!qSbu[y?N];FAY*WkDsy=-)+XӎPz9'Viռj]ޚ_7x.#Tj%#{ujUr*o^/y}4#R)Lz-UrÈpVϓ0.p/l 3getD;C,k0fֽَP%%8-CJ=l_! kmٷ7me&b,؉Q} t}?_Cq"N7챎>y /Q–z§D]O7Sʺu<; o1:qŜ"fu;zѦy6ʮ yêQjPEA?B}4<1ϥ#N 9xŐ(_)e>rFTdE(U_>/HȍUwƝ ym3:&wAH6LCYsduQfEy'8]!9O5iZ*gIPG!a`&mѓ {0j;^ѽ/.bG'z#&s2|HmAOdd}_^齳c`4iGYyq4QًZDV9ʪl2 8':&%?\ 7syހhb'}TWyJ@rI @xERN赈#As]H/Ƌz4::A+gMd_/k\?6ېIN8ԓ)xL%&~r-I+m6C۾O9s=|_Q㩁"ACD)ދ}Zx1Zn5v㊰B1Qu˧f'fHţGVw"$d əĭhHbyMdy-bYl-Wo)KHB+J10զ% C@[hWicf)2O[h񼒒rD:*T邐+PeH L{3Q6Mʇ<"$EDZ' 2rf~St3/6 _Gh^u#z/~T{X^ ÒvL1oKe!Ed!I&}~6Gz쑴4](-3~b藩M/ȍ5X/Ne# FNԴyHRiSn| r=\H6ϊrە 9z6r}}l8ҋnvN.ݘ!h0zpiRC'5^OB s-lw K_V[֗;S2lgۻ|e9ζ1^ \.ch? 5e̩Ѯ[vx.( *Wmbq?#!?(f,g$pƇ}5~1IɴOkmZQA(IF" ˈ~)kbk uDwBlIbg/yM̥>: Mr1|ќ=좵Xj:`oC rr9* AftV,D> 5Ԑ(#Rj'x\ FOLu"7f:&0p~gRyXmNmXE%!xx§"9`Y ‰)?Сx# u_ԓf#6Z 7@`oX [-3WXJbV׬\E곸LQhflL-ӊ"+cLdA4QnLUqg$b [EgGuF:iZ Ĵz2bN#[ki{ ^^sAB!sZw8G/Ĉ/saSQ}uv}Mυ r~zqm*xNeOGXG1S&f~!LjSqa#}1"ޜJ~_n1>PSC7vqȇp0[z}vYg|bm6&F퓉8=[?>%ů nz  Jcd*G0vvxc 6tG6]3kg`ici8bڐTՆcT#+0 TݐT|XK䢧{CV9lSr}W_y؂3|3BTߨdkp:Bس8* (7U|q)V肂K"U/$Χ)! 2dPU6_|wAX֪cjqJ~L0;ėFT/t]}aC?gY}L h[oX<wð6o1{}aw ]8'htDKB݊tBOKB a{z}|G%uzBW6٣h2oG17 Bt/'C/4ζf8?0f21\f,ڑ62B&"dkD_^Oyr:F4멱J#;B{ #Vw K;,cԴ)gu%vG9q,B(O`b'5B.Z!J~'[(a8;nz@nJxbP{t eZP#qlhh󐪿5: ECé)}++V.\_R2\lC}DflM  G1^Bujà_T/Ugu]H>@;[ ; d3@GM&#?U A"Y =s`:u*V~eAyDDPdv^7K>@cy r7PVkc>xs *O7C{zGǯʹa}O'qW/UONZ-xG-eHK28ci:L<>yG3'` Q_ D|^ 2A@@t>jv7xIGhl;یf\s_76 5F^ BC (v]­O!=9;Joد 򀘽Ez_l(3Vg 'jH&n:R3!iKi[I46l'9?LVjb̏WFN-b. :`P moZǡ?iz@'\O#&mEv1Ƿ[ZH׉ l_d 'VbiwkK6Op=MNLl*,e+[lN^܃L%.;ܳ<ax,gZ"f9R@ก:DJ/ԡvv3wij.4$_ɱ) Tc8S\p1c8&B ?bAq_TΛ1IA賫^{k_/;ULat]AQں^1 >کM)ww3ΰȽ;Ùx6r2QMa\.wT>].~P!0+F_&Z||80dXyw>bYF!{$ EZU15ҞE#\BD[eÅ&S(4S#]VsZUU3auT꨺jkIm^ȠzץHռC}MD+'9[$: R }?}ܚ껅މ;c)n/ ׼vCT% & nNk]sYjQpuij lHP{A֋:y-e5eo5>$ x"8&reNOFw˹lgZj6.|.71h7CA\q{-kmQEs?ܨķW鞮,A'ވymrko,ZOﰅ}%4{h!=\׹[ *dh}oƅ_1ݚ߸mYY't;INHP `IvEc\ҨY3_uUb-FpQաbѨU5zw6#nkāC[ؕ!MBA";!zjFE~q jIZO(f6L~}>]˘ג^͏X?!#.PiPV]c`Ik=k TG^k3År.Yr&ҒasզxoOB^R[Rl3wT;?ٛ88b$-wkkzNb2| jʊ,۩(=Xi8vLFc2L?{AH#4H?5||w;w乺e47cUKvrT?-{AazzՙG[JZc/u%T{LA^Hfj֦ZE7O*󞷚vMf]1}ܰ6aj\#},&$K3\H)@FKMFQF=(bxNOM h~s2oG%GD7Gg?`A9?q^xǽ%$as~x~Ʊh 4{ vY|gMSf4:%a+Q}I9! 򞇮 PxVj}7etdF}RLw<`0FPc#2Aq`ӨCWu7RJÐJ\)ՎzMX[bC)vo㘌fiJ" vK2›.khE~kgB#Gm&mJMRh|h{m`K|V 1W(buv.e!%p 3 ("j󰬠a}+gioQh2$!9qҸ>]=ɻQu`h-FݫiY s bĀJt0m}Qo8D \ЏپW a{ڇ$$$j'R?*{\9޹X݇؇'ᐦlSW?m./2m.Ֆ}F;m."8ZvmX*msŗ^cp&U-.tqvN#%#Y\s}Ijj3XO5wi-B}8Ttٌ`>/wk˽Kgԑ{ϟ?71J_-2S]ʍP ПΠ"xKUQuE*{(|XʝSܨX|$b;O%Q_̨L"\(-YeyB1'+l_L]FL*vNLLj߼|пm׿m? *ҥug^KK %6z͈ ezojMiҲ6=V ={Ǡm\ ,/#^ I}qB'5Kt7eukuBWd"m꥔(Fi/Ƞa3+ZCƵ3F92DFB=r768L2_jj0B:àMK+BO0ho눎}ں G< Y v(=,Up.1W[#W-(E?S(WiV1şgmɜ%2?@7wR+HM?}"p,jޓ cdwϘ1LX9+ˆM$~5^2iXK!" k.ϓqQ.eK懴%mJ(P:n~+C|EÙg{D/]P*K-Cc,J>H hPD7B ,4BU4PUx'jO^ %Xĝ3KӕrjFY_Ĉ4/% X([blRʉF;?Uaw Ri%F"-֟KlpSGX~~im\en!ï:fKnC67P?f-Mv96$;V eC(N̑3;E3OaSG6;qt "0 .j [QOШC%mEy Z8ի@4|3LaPπSaCNQ> azWQ{*5f %o*DŘDD\aRVkKP{cX>(W;0Z6 pk~PF.8nB&RshېW|ʧ5 h=ў{w4 cqS w`V0UUM@U5W{]Obk寸igevKT(w{xVZĿڻu*xQU)]/3@ I\?gqط|2Au9ҹAtoItCv_<dʄ{2Rl:a%PK'l)D玮hh4Qtm-[\&D!XBx҆<6M'Ea#Dv|FO:aQ٠:"K–8&v-e0t_65Jq{c#25 ;&^MjgQ;jH1iȒ4g#[XT;j+$E\=*u~Sd6[,,ٔeʲQ,9o#-̂J"!j Q i 4³E+Vu_ 5b˶g'kU }&:쳋U8eJoW@W?Yxؾmmm\KOk26~_,s&qe1$Y6"2Jq+3JB|TMp@>}ׅc%X#l !S3k@4]B'vu>}_z;;Nbk:vRs!#Lba%;JEV*+s)?/O?̱t8@0F/)taxiP\x\T5>"( AP2(FQ -7YB0ѷ%NICPe/]r9~JQbS[|XD$&N00 mLѡZx oV 0~:.aX pZʺJ!OM򴪣멅%W}Z1m]\ΪVָtal;7F/ gjp_mo.㴄6fF,y!A,LߝF5GB٨.ԯY] \烝E;/Rwp J@٨yNmg⼈5Qx4}' A熘*<4qÛ:_hF;yrV4kŲ!M4jU(bޣQ#V]'lV&6ӭM8wtFŜnVTRqRU*rrFnӥLhSY֥8}J/r/Y+ӈa'r2ax<"Rr1Ȗ0֕rݽæpN} Zo١JWVjV\̾Ztutg +SE O_R t i\N5{ZOU}{.UsH4Mbd`b%P4! ꋡt1t\&wB1:i# ^,t6"kB|ㅓp*o(qGʥӱ2*32p4׶\`w):p_zF~@m">vUuL-U'ȑY|j+:n`s ALb$IaP1/Xγ9n=r8~&=AHbf #;p't kwCaE/d/eh|㧙*Lm` ֜F4GS?B"Z}N.n6Z;ư Ib,UJk~v#9 ^*Ymm}DB_;Kt=>)9)KڥъRA gV#ܙr蘽b[#!_ ;re~&hW6gAt&Uo= OL:G: 8W*Dw([97SzPij]"?4m=a\ UkǧƨԈ%_͔@2 SyȫGtp0UBD169!WANQjayώ2BE8X+ <3bCŕhs'Yf³ $>oݰO~$☺3׳Ri!]/QޅBSc|FTA ,[O,Nֳ__ -&~Ͼ7ۨH4kOBZ嬕wvڬZuc~+.SӲ`c;:61&gˮ׿yHOٺ?AN @<\Wj'Ԗ0@a9vV?[b|x⪈OȊD/vŜKhیQ=~8ggl1^4 4ƩZb{q>QV]OKo%16ޱ]}(5ώ*ǽ554Kfp$l]16[a|duZ^2VcL_g_(ћ5PS_ ,1o?]څTxx WJsKS;rp8^MO-[źF2zժnPHp2C"/?4(O YL׫[8F m3Bk. BH5ZX*baEvDVT(©egnU:؁OC\,z~1]N5N\[7~39-L/!|R`j%R=(h׽Xg ,h4.3Mҗ tf"9Q^xCO;o˓Ge>J9ՋH:&g[<"iδ`cW1@ll)ne5H;[%7MiX8AVӄ࠘S_iՄo-g?&$`!p6vnzgaÄH\rP1uEc5q$}z>rпX1ф砿+YϝM pz!N;r*[kK42㦆:3ʞD{]Z5$*2Q$jC1:ѧxߖz~_n(HxqkoڑJ)9~ʗx'٬d,J#\@'1Te8Ŕ7`t. u ^}J@vK -[P\1|ZhG7|Q/f%'{Tq@6ypUepQqvJ(d+Ԓ.2^9({6[8IO9Oui5vo[zyjkW;T[;._.hE8$TSJ>ػ5eרB6m(pL=WlǁL}kV#'\{r]$.Gx2i4oѡ1;[yaZ>e/)DfLJrl\{gʂٻ|.gt iI/%[nw^2۟s}G ;cBuIqXc{?ndKE#s!AxI#p60aAXd$C7|M }O&p:wTM$FA@!=[Jg< Xf7pzk|z{\23h5w5 AFVq,:=ktMCK xTյ0<Id`N`Q#m4XAMd&2qBLFH-yC6s^Zom&&D `z҉6I9Zk{kkż#յVM` ~ۛP^I2:Z G7T~w=co']Z|6#@fxyRI+YqGF¬M;0Xp`gBn=zBǮjv`2a(5Yi,l2`tK(5uq*Vڮ3ŗ#f=cziyyxբl>xt .:L${u%gځ.ݿ OƮ/yХ(1ݶ]hk|$Jn"3mA!htcZ׿N-kyҋZQ3Gʼn:J9NGdN [v6x$ױ]}#ݧ:;z˸<_Uoqif,"[kҟ ]!}^vzb bMdY:u,/Q 4[c{M.hV;%mKtLp l"סsq-ZxGm#Ĵ+.O6 =ޞkA+!YosM/Nj<>1a^N =mkjћx0c'k^Qݕ4a0ix3ӑO  4Un+3Lt{ri6}j)wQ11tz3pWwg<,E#?z٫l&6Ny;AWWB]&;UpHkL[ֳj)&f<|]z:b<7wwJc>m42:בO^wq㭿MT4{^1aoea2Yۑ5^bݡֲ!4a**"ץ#aȩL ;"d"NaLޘ[Ukm,A9D ^|>s:>}!dP5 #@lZiw0VˀrLSmͿ"U]Y()3<@ \O~H(9 ʫ%|Ay8`2iD+xl0چy (m*؟f#(\{M>J8fV=mQh2*,мJɚ+ue@u$grQy >bMpE&-y7Arq@Q{A+ZFd 6i<1h/C4wKDP DD>T%s_6CP T 3 t:E5;F/Z ϓ]Ĉ}[k؎7>vaL;z;nGb}C(j\Gcyy}rKs쪱=s,doS.hp=cb$qk򄘙_4_k+èƊiىN$q(ڶ{-'mZ>_Sd -kxGM60 ", s!5"lF Q4Kkp'2!>#o7z2K;zqJWؤ,wiR`Yxط՟#߱QO؃6tG/Hum#!Rq|W aߧs<}4uM5SfT cm֊zp1.Ь B|M9}a`4kp`}J=+&šiOmл}JfEt^ i;iwӀW9@V=#[TsKs2n;@*xW!!d3o1Qj%:?/|ux< oK^]h~%AcG>qa~NGMXUVVK`n$m1nJ?Ǝ;:Ph4G'{&xxͼʳ47Q#RIw^QT mytQ1ӉOM_p%d} rhv̰#\sNc>Fӽdv@ ݙXanrh~BAqZ͵xg^8|+-e3t>O҂(1ݳw Iys%Z~Uꬷ* `j7fExSX_nJ{C_NI>'IV\A2y} Q1e=^d &1KVXj/`X)LYx^ xްH9C-dlWԓEpڊ+WJ)X)_>y+9v&w{rƙJ,Z7IprlLʅiK< e N_[ M6\ E7en͗P{3 1`Fð[WYt6m/QE>봓7o6C]!އJ~U\NIa>0?4Nk6$n5ڑy[? x} pnv*M-m;1 8OC9pwd?ÑuwPpd4̱ j?|lbcǀ}L8^Zo/1@6|uSYm#dYl-mElVkByyMo@ʘ&>!ʁ8ZCzKJp9EǮgQR,Q7}NyʶL2XPz}:G%I8ɯ9U[3ĥ1GF:.GXv4#M7'niS^<`sUdTGKxЕ5KNT> c)ĉgsk2j"O1cw,Yf&[I~:vdڨ2Y9ɝXu!GFBs6Ag(P}YÙ5wYH^8DH^1!rN$˗gB%x=z+qm"Kqqn63,3jnV"IΛg o]|R}ub18wWaD];J2!^m`ܰBETpsjQc rv;D_ BG mZI87k?EGMZc+"z M'>!2b@~pe4O'Eu0E^H$J,i31;$=oɯLlǗ(N.DڷW>rR嚢rM`u3D:a (fhm#PmLwf[Q #~(uPQjBG[[F_jܨhӶeDր PFKh4/avgNuN _`# c fmlKuXn [qxWG[?-FSb/ w Z76oǐ)d}', гl=;.U/ʋ@)%D]$_Cgj"h^wF:oL\g7EwLޙYf9n7[tVPEwa(>;vd;:vGzU&ZbhoY?,T&QQ{+@/#hQU(t<|NdҹRST`>ǎ瓖õ>ɥhَ%$̃iLps0Lpf`|+[Ѳ/||wt>(S\ giH_vԌ\%|M>'͉fr, Gve1p&H<N *tJ_!*[%2)&y2Dv&[v/J] R~U;sKW+#7IW比+%aJݷ$o]k:y䕻 u%+%e*Kݞݖ6֏ZD}Z4v 귭v - a>@zy.yǞᤈ BpwcOKHJd)h{8ª"Vi/sgdq#YܠkY:+;he<ҌҠp'1[l ~: L~?فM70 PpD]c=JćV;[)/r:l'=6$u`1=#1:a4;zypty#uǛ^ALΡg(Q+'1yuJ)*yԟ~,HMkb^FSp=4:H hw܃mdL`b/uS2+ޮZ8W8e<SӪhp o!Pbr]($k4U=7^x)сhՌkdwnB^8NV}{g&=%H7mCzKmW B?~[I&Im2 _2rJ-B&I\Hnua>o$k%jNi& hBr5//f0BDM\\yM.`BVqʥy 2rдp(.k'֎NFxL׏L>ydxS+r  ۑCүat9̐7C?b\h툆}LMxuK7`cpnfGz_O7$tIi)CS)LJ4T~|ׄa! OsSFЮ*$^gr)`v ty#P0 &V%Hèg9ޱ+0-:z?J uP6gحxg׮zy^%g6yȏ%17iB$ +#FmxA=y-(~31!ToqRF7j_| .2KyThȍ|eX(eQnf]fK;zI3FQZ9F|l =Ε"^K"7*L+A(E/ WPR=L=0$lA $Si "m,}è^%2i1 e^C $*`;1[IVB@(DSȌE-E?Eud6Ղ~<@SzKK{v="رo )T0T]q,hchv˫]J^3FޱNJuȻԊ^ʼe_ЇLo'48481]qU,~b@k7C3wjp@f)0Um泳J[K(/ \#"^k2]#іD)A,CzkkOzrdWGPײ~EF_IT Gu!7hkM|+YCtoz<5ԄAy@E&6zR_.5x:H%%G~.2ކ~.j);Z5x+ 77^׻̫'G k#X -btڹ@Ma27&f.$r>JU개^ӖM:z,iL (O̡IU|.#09ߋ@ڷ@e fm;R!|0z2(Mrƹx-V4褾Ԣ"th2v[Zhm!mo?.~gRÑʂZaNF+Za&҆O,G}y)󋥽}#bk_ iv5eFVI/ѶNT{ osEI/)|56[U4Qg5Q+TxÕ},qT-o;$@ZXQQwOb5m|ێ5P! L9zJjt?؝hm ImR'u8ն /0og2ILк(ca R>ѹJ6͡KQ@%$'F(#F9oR :T ?*!C< ('JJhFFrt!L RmmӹKxF2\Ԝ!9Kԛ[ }Zhcv9ᖌ}L6)ks夕;'Ls9ʅ5)Î)',UpT8n(|4Ȼ%r a}6s/>y\+:E6Ht&&|y&hva(W dX?%z ڞl9X; um^SV =:MuOHkB (5'XE R,Au8v=/sL$w@I +T w C:D X% YB϶PWaS.IvEL.lُ?SKHJGͦ %"gPAhkGrbһQ?YGVPVIiMWp;`>:eAvWSihҸ-Tz4Bv7 +.ZJ&&2=F"/ j7AATXʅ61kϗ3+W:݂ezm}F@G WHLRާK[noN-,Coݙ$#V: 9032:ж*3tمZtSىuj!EP!cg*-T1XfА_I3.#Ņ kg6 X*b t~lv #ò5ڐREXq&岦Q__Y' es,L`q%.@k VbNf'Λ3a9E\KEhы"Xu-Cܖd^AXwON<u V XXUt&6qQ+7+a-,NF<~3vҶ{C0N =(eP_*H.">95 b@njKH$?6XEmܬM 쎢!XY(g1gV=H;^ 0űY&?.mZc烸 27V:,72[D{p˘nBwGƅz0NHsmv}bQGfwOb+){I9i=[]c?CwHWe+4S:M:t$N>x8Im\:tg/8?T >ڸ-֗! BU`b0$,GN:JuIu)]FDtq_VnN89=u6`po-$v|L0ӛ'v5^+y [AMqNLvẗ́.ͱT)A0{:PT귧-a_q^H!IzQypNξ7]AXk98n߇}H@嗾1-/WzcHCɥj->q{UBQVՙ >)!txD #0zs['Lن\ 6 &~i}A=^׉Be,'`/t(j~BXˬuӬXub5-XҞM(|ncCoN-?sOl;5(`VRǮd5#¶9C@e!=9Tc]4K m_j'Ƀ/0ӕޢpA4)&BG,U+Bȸ|rUwmB. MMsBg\璉WƜN"'q&]zCm3F>AvrjzL™m9 }Ey,@"(H*nDG)IXǣ,dH6X"Ik5SD&Rr8Sʯ06t+ÎQPv ۜj+w(Q~Uq}g q',,*{~NZʓ UN1F`7 e!'-b![h@hJx x BU/|[;ݱ%EgFm&4gۡPeh"щL2*7g9tV-zΧlZ5im>VbrOJ)x+:񖺄VuBN܂C)Ό5YѢ/pkCҠHL65uFx94Q\4j9'z=6S7٫NZ`5f@x f%~B;_x?ClUdr@\W:vZvG~mI;_M_M3M]F_< p/Mhx c/) 6'es?̜B9$'kߧ.j^{[N}e!ʮ0YHoH'ͼlG#Ua_N?]F+6+QT/M鳹Ŷ3!]pb+Mi800ɾ7&vC##~ Vtנտ mI氞D=okQmWZ܃NTeQvc.={ZZn]nxC7:l%'pFbEz lBsqJO ٢6ր٥ݸ P:L|v2F*O=킣t;%7HN@BgOK&`0*^]ugOgFzLkC\6;V9yo'j<XAİO95KdՌ":3˂Bc1Ŷׇϥ|{In`L?ז\t ;3 =OE^fRhwjl0Eom=qpw;@KinscZ򤬨1uFh ɤ Ke>@MY'5I~ϲPdY$ls[yID-I.B=řE qNԥIM}{e{]1',`js)V(!щ?|NY)):تX>OSj +Y G˛aG 0cA&D%eۖVcY3Fc1vǤoZ8x3[<6m?訳`/LQkOlHؕ4f&ЂԮa5cDŽQcW(np{ Vz l9jfgmD^u ) ,`˺yR\ߌh|sp7EGE26mk[4ʆɚݤBh ڦfr'nY<gW&WU)e4hiIj'hU-%F#m`Sr!נPur41Y)4Fўee.u2AIʠ-᳣?d+s)D2u28/D *QLV,aۧ5v?y!/=,__(M) =4ׂN.a]8eaA40]s{bT #pCE/0L98@BP8;1zNtBk~]2o%0YTՐr|Ț1ϩZvy`CQy "{T0Wizy93y\ufyH#՟Rָ[}[%_LK 3]SؙR4/Np"RV ,\~[; ~߀貘h^^J)@N"SZ?Ε7K=e|ݻ[djE3IyGA:uR15M}F6f^;G#Vm)KM|>cB if6ߴ%ڌůEXU6WqarvE UE-j.ToZڿP¸AqA;3_&xf\ p'=@>vPuc9;X3UM,}S: ɿ3旡l܀M6I,ߢgaݯ/(. gkE^E 2 98hs(9X17P\Sp7ԆI ;eTp4x&}OmOU+|lE%{R C\aRGaTg;ťk 0 (v8QNvvi|.qxpJR#\kHDu$'ڪi[y4'77.:d}}N*N-gA¯ i_VN†h  0NW$']=M]I/R.H#XPŠ ܮQ9/Iv'@:жC&MYzU::D甀uv FAђ<]i`PM2&Duc"[٨r W%r!fqJЈ.c,ObiH%`Ι,#E?#3yT=N_v ]S 3Vn=' ) $%J Ѯ !.|" ݋V 0-\r챚FP@َ$ B= mnSgimA@>utןW::$-QTp?4K" }χHG ؒ_wd1Ȳy0C h{^FwUpN0B]f@3N+~تX KډYcRͱL_\fmZb$<3;# G2'鑄.%W"' Msww61 <ذIv߬x}DVGaI]$tNWPE НGz;QEs_ =vQGv`-ߍ+kWwIU!I!ghP ®Z^-NT2H1+y#?eDKlkho7u7yHh39^)'}'@EN r'zdo +!Wi~K.[5mJi})Lq&d!!VPsv*+ĔTU[;M~$@?I]Oj#A3F*- xĥҗ O^jk BNY85^q_Kg}(=u[/=щSTjW؀ qVeiV΋m'.Uh.%nE$:؉Ԍ6ڕM*f|v;۟0VغzdVA0@|RoQܙmmr`Z.ǞhkҨk"̴|kIo\?ۤ7M|aUiN?[U8jQ]@}|OaeZmX_#cq< hb2_DO@b)2G C0}H2LQI P w ޓ4}p8 p;]…R̠6G?յ֑:Tbg #]y!H1P1@f ',L+fԛ&s"bLt-hjZ9GS5ʽ)L25FOK4iPϧs }gySG'焟`:G#>Q $@u?ʒQ^هxeᕍ}2`Hmr{RK2hO>gvf/Jvx+P5r'">;P2>澺ی+/ B ss"%చ9r߃̤frk䣿MNܧkJ"Tkc a/"^#UcOXJ^5;:t=a"<5GL_yF@;>v|sحh!Dmq <gc~1'teϛ. Ljs`HlU;g o[l cohՀ >.ש!h#;Ԁ?j ?o$THksZ培یQ*&.'B^qV ]Rِ)Mp4JD]ϓXrNrB#&C\dv-K^0kU]7J%ƻ/~u]ϼwpJˢְ/6j6X$Evc2x|aUc̻1z#nU=힖fYJ^V,Iް9(k 357~[Y2*1$^~Gm+{p -G;v^l t Wgg Dymd=\(I@o*"jOz΄}\BxK HA>=4כw+TV}~Cz$NKe:S(gA@q4@c9T4 飶 9?5#(*k^%UrePNX Xډ^jjsr!.Y.q򸤱HSjOLױ™SU+3YǷo_&ulbu G >夵j1|ȼ_aFjw{+5v *.Q̫֘+ ݾ*O4ق-v} ֽY4J]Ɠ;'DA^VJ*㻳luֈǒ튤+Z)<ԡƒZc7 Ni t}ef,žbY+מS5mgt0Oq_`+9}-o+ S4hx8ȓQ]9.sy !BiRz_L֏i-B? +e'-A$WF1DzqZ(Ǐ}2XO.a5Ͻva'NF*7{v&m8ܸZU;TϨ;htgO9~WaF9(Į؅8OflLn [mZk/\D9QN @%y1Lֲ<>|#9lkme& ྺv\ `&!ّބՔpZLywU ء%Hfϱs.HO=BUUnP6~A d0DiFQdl1;jCx=#aێkPFR!{EA&kwCql; O`t2%}'a\ s5 zy" _זnmWmAZy^U&̱+` ѯ\e3:z-Yy I9vi "I݂D6Y*~[m}=[v#,xRCK \\ՙ0>M21  *8&kq4$-CHѹGkWn?ڮim $H01Z=8dH<mwps9ۤUQ ]I=Ant~GPAOp uL|xR XYӥ'αdB#9@9U\жt^: *jOXpC C^ATܱ]R@ri:9)'ǭbxkp&>qCKBɯwdg9YÕ" sIڈϯ*j}2y h!@n"_߲|Qڤ<\p= W9C0^׳p:j>,e5j泚M /*>[߲R-]Sww{YൽϰifAKø9,Kj!^| L'>{!V~Ž&ӽZ-`cW` #9 %4ϭO:_0_cFǤd{?:C'a;ϫGO3C#P |UzJ= wvGƗ7Jdg{>˽zIm`[mfo߼ Z'|u˰],ܫiG.' $4]( {6Vf_CB<^mШ5$VW* ш8$Şwşg=R0XZZbS<{L$t|d:MYNWؤD+ƻW1hVLqDj~XzNd]ĵrF= 8<rH'`,g&HFdVHV;恬HV ٕB^''ҖA+9@,h5ZEkӢhm0>V>2$D$pNaHuT"KpLNdʯt2ׁXtjkh)W(MR?b&;%4j3d(q 0{J`VA}&*5avz ZOIz aW?r10k= h_?p1(={1D4R L 8'~\ҁ6+xi2+z-ڔ 4:Y;mAkM}&{=ڔ@NgL:k%aaD/5QaEpѠk)SW9X1+3a|5eQ>{Q]$ISg(&g]/dEo‹;{e6^%CK?̱IjKa[ޤnNa}^vnZMȺ{R~:G2՚4KOtzkzor[OE/YzGl;_L犐'Blsmh O?$ߐ RdHt.̓68\#ĸ%x?QҍZ5/qWXϛk}xg ^AtE-fzpy#;ޗ|;k:b [CT ͂8_n򶤶.UIz3+AJceW*k¥M<@/\F( fk/瑅ɡ]"18ҷFamr`45fvBά IGJt~ Kꑀߡ| &Zbm^|9&37R ֥h[ xI76NM1Q ưj/Fw%uJ<\QxYjT%SԗGjܪ/_\ag*DIyu|d~?G,pp3]^a{:uH:i'SV:< R#sΎkPтTҎM2a3؞+wM0xs]=呶]r +v@ IoVNG{I^ pAp&m㦏M+Kx`1}57EJzW1g<~(0?}<J;I4Z;G-\Q`f PsbɽdmC-f!ݕl{lx +95d5ds??k 5X`ͤ[9 سgf\-4@@1 aacZr]]ҶE ͒1hAkXx}['૚AkAzwҁmq|zrakQ1%[@dI\TNiH74PZe iwG4yQǮk`t5X^i]Û&^?4ʧK<]L2F19∵͑v1v:Gy  9 G)"ugsT.Fύ]g@@`mѠ_k"fÙh/ی6gbϥ>VkO]wp HCK$ܗU3W:w_)A'k}-w*N`K8i/j}$vi&SRdtq<ӓLgp77mVR/-2&#p➅&Zոr5͸ڌkqkq4YU05Ǹx^ %9&g{֑ %0^FĩH_P?' rw@f@ki- wh a\OKTo)u%OΩӎr{*#[97,mZCI"irgl߲ c-Lu|QlUm{H hYܝXlU 1 KUrU )^Z@|*rկV'9D:Nf֦k͵IAmKUpO|93 Ӛr6#/P]ع z,;PSpz.l{LmFz'.AGl#ptIRq0 a9z&,imqY ;T)Duk⤡uDvmsGӜj0)N8=I@9Q?v`"ЬD Or[;=I14:듸IPXV[s1_ BG kKgT3qmթgbQbIXLcNOrg:ˉ o@/nᷗǯ2}4%x?X 4-|zIuvbp0 0 6=1ZSܣ-6YSMo5hޘpńcAi$xq濔.!~Dzy&ńgz=n_7x1݀yq0o̙YBt >4%!,$R:3ў7C.[Q&7jrQCk-G:E(i-jJ>oj۵&bK;4!xg6m6rM_|M -IW$`ޙA\ 0|o,C:'@'1G j>gj!ꛃ|vgrd8m e9(mF\IU.Z:hB> waMC"VxM G Ar`P9\ëmCܳjWၟ&㙿ڤ0FJ%OWi"}*ﳲ͗UBVt;7XucBIq As']a wK=dmF=$tr.7@@wFpu93 Ts 9OtŷYH^PNK܉F}GD 1E^_pϼfpR,;߱:\<.?!9}дn\1> ė: _ߠhw .h~/]qj[tGUwKOF<ܞn;FElOk5XM&#sc(дɺL96(ܖ[*FX9_r]P҃yjCPd|%ϛ96 l° JEa3O.r/PA|qqם;h [͆ G>׆krQ:RvؕzS-N@c N4XࠈvUmnvN܏763Ό.8Amd+`Fl:,> c@j8q gfX3XAӚcsRxX_0'm!V >,H @Mnp.>T.D ٤ߨ͔>쇞䉑J }f䗆ou P/Zmx*7$+#< Bܻa0ue  LrV 1N93:S^6v?P+4[)#ZEr oKf_*etI5ٔd;d LuC6( 锿MЅ ރAL/LM'rf#LuX'hN|õ6):|Mz ~<~Qx!{ >T{9 7qϔjLTc)?SyV)+䤌xl ^܀1bd}VNC~Cj'ϨDZZZWZֿ߭ hbQFB{rUTNBy@bo[AU+ tm4.wSY꼠SˮPx_#εO-B<wWz˶+br!b1Z{0^(g!m7=[sCSj1f8_ղ>y^f]s۷}O}6|X#V^O^HA/u;B勏UByܜ@bdq. F_Dⲭ(M#Q=jALĚʨH0L9gs^=jT} %b܋)yK-IB"黓l0H>8ץW%e{89) 4)K#@zf, n̔T:Q:1a`/&@kg+29Ǻd3c 715_f54*gsD@;61!(1h4o :߇4Mr6BɄRNjB4L,M-,2p&#fd}^jD*LCmڿu I/>|T!v!oŃ633|ʷUC_iϐ܅AѣNbB|-r&(||-vⱩ~ynx-g%+hM؂ K0TS[S5]PemF"g?i"{?̳kY u W4@TnV.DVAh9OH5H|VA( M5zccu5j4L \Mъ/aZq_Kbݬ4uzHPf}`Ƌj1}^`mqD[F[b5u~jKyv\]}Pu3WŃ(eżYK0;@Z0@JQ j+қ@7p/&E#G0R@aCweh1;hUm8E@%h  [0%ˢ 90Z$Cj:1sx%3af=u1_$ w﬩thTo%=<[I`;?N'[Vgazv>1PTk(gLzt=Ϲ@G$F28&쵚12[ ^٭@e.ՏaN&N/ Bė?hӫش 4ῇPC2 (^'>s{cI溎b<vL"FL>֒::/(çou\q qO|J^_$JWSbe{Q wў }1ʀuëC)\|xH @EehC$4{9*FQFTU 5bLX#Gz/ZjƒE?1ҞjԻIr4eF)FDr/}:g0KH;[faXg)W(kpXA dΥ ^Mju%OjMl իc vG%n*8`4;BrEϭ7y>WVVwUZC^0kCzV[KrR+Os,8X9Õ8'X'Vkeïmf¤ 0mqU~3{cX`Ɍ Kx9'v"*y |-3UASWA -pcf~&GWRvR?=B?~ROݣ }r =q)X-Pyz:4֬4W:pi5l&Am_/"m8#^=ptHрSv\Y(!b$耈hJx-`9utWz3IUk* E-7A2WH1 /*X*z ž b(J5YX8s )i,N/ y q%׶s?G0@$yYi4Ҩ,TCTmTuۮڎ/ky a%}I:v,4#WezW/0Úī+,]g2IA  :LKj{=W@ jB2:z0a!#qi r:d}y ?˴#τ2B [7:W A,Q|7&ecֺԃwO4O0< 4O:4ݓdQ^?ZU 5 sY%{b-Veg 5Қ/HeJgl$Nr=5E . 2Sz?ް1QB|u.戴*_nVv=~Hs4}$((^\F0zo 0YZx\\X&,kp=$x gI^]䁟`'*ʘ?/f")Fzdy4\ p'uX,TEbvJN_8͍zO&T7݆B;~BwUTϸ}H&JzY63M̻${g?|gc$a.LrkDkۊIܩ'*Jye>.}06#q=ݘ |̖] 7ی1EZ)dܛX\s&yu͢B&A?t'̎1,O1VCңCp0>d6MiGgU\*5zab<'?Xg}§T9kN~^s-D'282͉< fdW`n{ -f_ rhnw CuxxFgPAGtzRUƩlANSqTKQFg : ; $5eT'G)3",]7RWx3W 0+`ؙـeftW3lRn(.Kh6~# ,(;z9Z=EM䑩h%l{ّnRŬPBY pi}ՅDSO!;%v84}rOvm(<Ǔԟ3X۵o hZͣ'&&"#L8"cL7*܍ [{|zeԖelݡw> O_vQ>y9yzQ}#-ݽæjъy\n b/,ߵv1 8xl5wg@?1DC<-:;j~zdP} tѓːNf92$X|ICYcą,^geӌ)p,*>uݦiظcخ0ҤY ћ0MPO:vp[|3偧)4?9mg-Lm4M0vhwc̷,IyzH,AmjK.|'?]cM X5cM|ίΡ"T9D"1T!ETRLa2Lt:[Lr&V<[^N74{jq*X?s޻J'g|JISpvE{6k+`*6k`[iWv4W1;` ԩ]+ #۫UVyD& V.-;˰ >P8< S^7ܲ,&A迣3ndN_ ܇Lp:nh瘶4Km36H ܼ磵?pDkEٳRe_$˜Y`[fCq2Q'pH/ WO 5W!з\o)5Iy-Yx:v5 }R>A[o1& `-Q2NB2N߸ >Fs}^1_h]TO,f͉<~̇aXLP2=e:F֒ĝh sT+ߊ'jA[CN <=4uto-*?00=Y4>}XKwuFX*ಏg35së>^ \2nΛdsŠ?,`]6,Wކ$WPi&}v?u)cO|ᛉhGN7Tdid?zS<}2m bJB_,<GHńj,43)I -LXIm sC]a$ `rxIA2e߲P姿ˁ'5T߬cKkn0<;-5Ђ~~}Gu᭦Ec_*SҴ7&4Zd{s O*8ɀDsnNj?pn"!8w3=!]҆ [b~KƧ-9 p3_Uxz QT,$=&9+ҭm&i~;op󿻎 v=, p{COE87''U27a&[e,{'CF6~,!q2̒ pU\#Pw]rJ?`9mяtrĘ Y12:{ҐF4I)a:pI^@sԡF~K0=u*0LMnoQ+ x+%v7K@; )%XˉԉڠMh'e[5d߄;ʏH x |&F? `dPS4'|O;Mp⃕*|fCybс:ŇXx>4vK "+0~rז; T Cf:wPbU=E|T/kl7$U㌩#r,=U|(5\SӹəR xj62rm2_E~Z\V&C?P0(*S4 k;+y<`>>,!n4 *Ld*HUy Ni`pUQb8vq^|7&fKr&iJ )tUZ՘xa]%yHb*[T 4H/ yڟ )h~^ɡ4Jն9h;vՊWx`.F-EؕLTy:L5/1 s f>ݨjw3\sF} ~[ЂܬpA'ڭ՛wLZ! K#&~e3O{ =,ٮv jM*%KZcn'Y 2Ԛ|[!-id*bXuFYsRDSﲖ6OO-;b~ċ-s6"&XcP+wߘBB,骟褿ᢗXNzCy҈ |ea:m\p-*۲-W\&ٶI"ަώL=}Qۙ$Η\C5~ )g~dlV 'Y?VW]j}X!4ə:1SlpH/Oc~E "t*Th35S]0 D(BԼn(`'bǧ$.gg8jHH!4mKCQ+][̕l4i{a|!%[[ >v4%cl`j4=~yx3cwP\ :܌]QxwM/Ve7a!hy8'@=M?̓Sr{wpW=阠‰r"9x<<tgE0ief$,'ӺWgHo nLC=T8" I[ࠟ۟2@{uH޻W )oKfȃqR6lQ~n->ջpA_@*Ƌ}4$$#z>/w1W5"U^o5TMV<؉>[?,p14m%wڒڮ^?Sx-"]F^(ض֥'k/տ-2Zo7^;y,XP`i<4u*5o|w}w0 }zJCTA|m-GJ],Z{Z'r'^N?..g}2R.I<%tBLIÂ9/`ч4cCWþ6?D w!qsWc2TqV@MQ4F7;?zQ#4(0k0) !ȼ \_\+`M`SdcC|tsz/21}=[ǧײY x!]qX"K%dC(Nf^ ,yj.A>ݜgO&=43ќ0lL`@m-y|5B Du .y3nՂ<~36ߺ|nIx05I]0~zZ;a>ɷUZ[&ie%JSJqM@6لʵķ.9\GAﱓ~we1Ҽ1*<卤Da 2?p; m~?9 ǻzN=VvEK=RSmig4 ;;ࠬbUDGYCi?jX6/{,B' 50ֵS0ͫ*Nk-'Q|6Sby=E.<,Yjx/;ko :#WA3!{n(QU|U߃u7;;=N{4jFQ߿j6xfz,PX[V ʷ:FxX%>* }K-`j|EcۇwU\[)JJrwtXJRS(ws,&ШhP ӻ=T%5Jr'y披ނv+e-!R)ȹXRJWAObkHr_31>Tiπf-7\)4*gQ̐ EȵC@bEγ𣀳c#cSFg4-i-v [?6xona\ i퇚Ӏ]ǛHhecH ƶ׶=p93=@5v\%jj}:zt!gj@d X"߂Czc0͛GWjNW^1H~ip|-zvρO.)sg(5Qe{24AFA\Cfj{n٩+" (2MzTk#w#E̍a䀳f2J!J'^Bϓ401B_{YL1AZ$s?t0P{T0 $G7Snel׶@q;2ȳVk`M02Hd/& y+FږA5r.}fR#wt^*9+_|b2rpF*5?Ze.mtG ͞؞.2عȵx4޸ƽٓDu\dLEZy)|~pW7cȘ hMϖ6!C&4?b<5h/ M#qؚH~0 %Z^˟0_Zo(]tױ)hHvZs!SS shU@xw~XjQZpr^;'CfWNIh,@U g?c+1/-ehggQ?%n$^ΰOrW(Q҈O|L܀T>dbЃg٨ɇ,ۧ*baPZ8WJF|Cy#8 n;@\d.6VȢpO0?LJ~p=0jCگLUE0m6h%x[w7nʦfncg KPنb*Y&#[ \A-ENrCskY54B Eh僙Ӌp#K8+aׂfW;95%P7Ǫg.( ߨXGɺ@b,Q9II_Y KٛQJ&>Jt%Iĝjht+8jp&vCup\O8 xT/hl }#@nՍ7MSZCVkz?Vhk{4LFk!>P{ȃi} w%puHQ"L]<4҈z&0sImLk7 ,\wF]̎WmLTȞ {tϹ`0O|HLoK-#XšeMT 0$H<V] 2rjѫ1UDSW(g6nN>N;GƩI4g*(% .2HVO.}&H.1}0eXax 72ʩSZ0vfZ)~E&d]Wh["& ĚL+wLКGQ٣gs"TQ v$mNO)C-`cPǿ]д\dNy;1xaݭǀ4˺oXKzۛl@KhmEי"LeD,O[:=Q&Ցs( Q9ѫ9@Z = l^=ytZb!>GIlށ{޳w#=:|Eazx[Ycb6uŴ0ܺ< e0$'IOBBrΏ^?ˆ]),/q~B*b"Z iXe5*UVeH/>aoQlS8!.~)V '~wS 6fJiY\ |^_u@sz{j_\Ll3C.hA |C h.E7ݬS$:h/<sS 5=W9{笈T;2) Ǥ">G(j;&vY+s!Hձ 輝y3 '&F~vGѪіL!ZSbF7~I\TP EetkB?%p6`\`y!JoQIWe %`KP備 {OH$Yp2SI W&l= n܇VO}>}2N m#lqAnIz_F8?v=7uwh}hL{ j1ǐASCw`nQp ➁ZV|&acc0xwG]b>IFٕ1hALs-'ݯn.U];6ۨT?Io/$P[uM43sF$CEE誧 z!˾KwÞw^"6욎) Ɯ,Zȣ,u㐶M7#v<.{ ,w!o)^7nu#HcJNuUf9qyX~Y,ldͯ=,,Tdta]eއS}f݈eUnlwtKXBW)m[:t!T_9icUNwd!& [ }&ݎc'pBbPzݍH$f 4<֕3Sc".?]۩ΡiLŎےFn Mª, ^>.a<Ɏ{L:OB?TAyCWOp+Wɺ"c>r8|:=muuz&j gE9I2OWP{U)˩>=k8]v!2&gވk(@۠[Mw/w]`!Ug6J B{P*KZX|%U` _ &>DVX*~:]7S>\fxi ê9{+,Y ;vC0ˆ Hjnbf(1"NDӶrd BDY`:;p^pS`rr%ga&4+Bk-k,{ngEOCK`S?ihhTXΊUPElmVP@ -!S\JCYZz wnm8 gN'ee>5U;9Ͻiq?}y993īЗPojogɅp;a qBVu {s;Ĩ<4ډ}b솺#g?6.G[ȞniAO==h;{MxZ‰قvCˡwp;c形}7`G'NakKq5WƄY1;4V֬$ӌ-ɭ][|9nVCVGZOpH!uƫyM`<41\ qFyd1 _/Bw'z[9`.D Z6lQ7Kx{+]DloZkE| u#g)FSJ8 ^IyOy;pז:ۡX+aOi+U/fcHc*"`(}05Kp4cZö6%6K`לU?:qY\P WgQU Qq*hYgKn c,!Ktyp {n~'^nb-qh-JD6x֤ Lp#?^ӄ ӕCv цF rhj5Htr+w>3ɑx.Ze<`J<+Zߊ1zI 94n(Yգ-è&Q CsgSm *`4v4L 8L=(~.G&q+u4ؖ=֔ks s=F/,kŧ,3\WN9lxZ͟4w#꽠cWS8]t~z"Β(8ieeqY -\v 0wn)y\^ W`I[zñx/]v ѓuѓ!]G[Gš)Fm%\'Y*Kl7%ٵ7*4Ut{=^@3r94˜ήpǿs"!ڐ#enBأN=D|fj.fpeʔ b+oI1bRYLzm'důqWf,>7;)45{bYELkX_ ͺ^Vūڣͥt(d,|\'ṚJ= kO՚o ]]E,R}K&SI~ Lpox0FN+ވlT;wuU@%H0wgU? ;Ml\{QN3bMZ~נmA(yfn~CHLr.pg:W[{hgUh+E r$F>" 7q K;iO;H6ݚ/I.ģ賻s)_vlM)2AqIc*b`{È>/J@Tz`gF8f:Ѣ-sX} rV-?Ӿbxq:@OC&oclny6k iyAڮz d266Z/8 ;cpBt{ʿqVd7ho^Ⱥi/h[_2*k2f+R0@u+'N3:S(8eź!r{D|)d"52Y;iC>; s"(wM9AC}NzcfUH@[]&l#; `-F@.kkf YuU|\ZO*H)+*JhV%}0hyf$&ZˆI4sᖏD98]ofq0~Qgc$U/(N2 0ɷ(i}ӵϟ0 ]m>j/vCZ@~*qЫ,Tܵpm's#NRcC[p|YOCζ&si4yl#6hNY6w&-tVMXd+`ˣ--Jz0ei}2,p"H@ɂiSMv>qzm}Zl=hMeµ6!B'@-wiKТhW<Ixү~i#Q`b{}-t•4`WIȊ&n&2]%OOgLB|OGyll~+n'{ukfkHԜF@"_LFwQuo!,rr[ܤ ò 7Mo.T΋>PdQ\jD jP+ 8Høӳ=?-fLFi*fAe5k@j9R]|-çU'gSFA-2SR׬AQD㗑8甄3:cp.B0ޓ3 gĝEvK"m"3N*Y*4Ko1e~CmMj3r\YoQƆ|2#hY (Y^&bK 0{/3;;2E'bUO#KzªP.;2WN[?P#n-*MSl֗Ri^˙0Mȍ0}% w^;ւc+Zbխj;r?=_5YoWym{{b[{ggTiǬ=մ[oӼM{ p:̓)ˏl\sQwWQ%ѓ]9qnvïC7FfW+-;5[|e>3 0k;>3Hʳ:yoRg]:l7o wۓJRf:+R{Hqi*f'2]ןN3ݾ9 麎< n%ܕG$Ls1 %}}=-n_sxKbf2/ƊV+RN_G~xzszE} S]շuӯ/9:YrtҌ𰺠śh@*/ fCIY1ubvGAߑO"wv~Z3N,[z^~Q7@ uB08 T ]uK%7F'n/ę aZVLt5Í03>h`{+2g_뱚rd6$>C|uNc ҵ fe.{vA{+2IlX1_TUN4zڅѰ3.Ev_

ܔb&z3*ˏ0<ӺeΈ3P89WS+&T< & R&H|bl+ĞƏf[- ny;V#6v:|VG/4ĻJ"ǭ8l~&日rhV2eW4k;t-#:DUdȆ -rq4ⴐ\[<@kۋ{a/.uƻIѻI _¦0X3\t̤88nq?}īUhK.6^/>)is$_ߛrNl1&+HTŽ0Ḭk5NeNy( =1 @ݚ+F,vc\[@s (_2Ohj@{ /nG8 颠\3MT+8I|`Vr72vC UmB%ݮ~2(½T當}P<8nNfuOFh◐Aki (tycULچF;WdPX*]h*y|>C^ lKotIbNk.F/Ş6QF.ZYgYozd1Ahkp/E`7Ahsy۠5ۘq,7o6Ǣs8 G(W|z᧌Ep@#CiNŸ/HAm<`H4D4a* K9FF;ǚˁy[ W{M6d&Tz' P(/j׭ƨZ4rPnk5⹪7[8\kb\?.| T &0 H2ÍAGiZLTgPM~FLTii\fN̠ ̸Uk='6m">hkkY, cJyUjߗ.Gzv_m0W[%3Hn=4^ϱzIďl94Q/8ٳP wh-&$df؍uao heF愝Pۮ5MOPiCӻ̻H9IHsa;fX,)\GxU|oDDƃ\<&ȓvsA H{qҖ9ǷG2hCt6^Q ߓ7HAAt?5#><;ĵ6:a|+:?ޡy2l]~+R?^i KQ߷ˠAr.L4BWV+2ׅ;h!~1,ت6K_I}zYc;C]4 _q0k'ߺn4Dǽl eXY踣7RҸa3W I1d'f./nww:lgm=qT7P:)B%Wوi 'NI,S!Op!Qv8Mt@cxjt7P9Nw9{t~$--˗S,A1ӡln)\Mr%;(Wzy:vUn}vӍuI=p/lɭIv,2xq:/k= 4b4֚ͅ}gX9ɯ]г!M~hZ\9{!D*`x+~vMbA\+87[0F?lȅד<ܘb׌lCT ,S>Zܡ˜ ΁{ŧi&jm B >ήpzIcWFA|6яͅ"Lp&<ΊVJ,_inU~~+PܚAW H&mR7.] r^XhMA&ՄeM\ӘmOǮvˣGlC&K{ߠ= W[/-ca? 'L&x__K@l~nKub=zr Ta;J]I 54Ɣfx>r;h7͓6Z*mXd'R eLv9%)J8 {lX7RW'$4O\eʎ%8-mJᰲ}[%?Ұ@X@OUR q MThj"rc c_H2zmGжxCrn6 6ıʹ9 cVʸ:9A;hh: 豉#΂CoތUk Mv#R]r+9DٵI}$+d%҆NCߖII2ކcZJ#lӋ>*-6F!FOQܫe/oX75GЯPcޟO#M a'Ṅh|/k}]1`S1%#1 6"'fvQq: B0eCR{P;ۂe _%"blX!H5搘5KLaĬ +]p\*U՘1+ˈdqCGQ1qO0B,lJj5Gˆ##>U_&ŭ|Qulٲh n0ne/ɶml'vTMviAE+Q$Imx1`TJDItk,eh{ q( KG:ȕP+>tQ/4*LE uGMZflVui=( w_CvZ{THdrK|JU0^>Cd#p|{TUoT8ӟJ #%c?J&zif"an_N3~Q;~ [gmm%nz4qV_md繝# Qy}xpl}/CHk۵x}[›OM\DkS!3m2uU8pz,G+ /k92ɶ9>A >Ͱ7HGzăԅ- ͓S>QNVŒzan Csg[mT͉73T[,rP'džn7^ތ uz9JsL]qBI30"0:5b{@ uI^?eǦ_XxνV0nuc7ܺ!e̲VYm)3;`eFc0O=3J,rJ)Zɂ̨h"Mzݑe{;QiuM;@il]r."ӌ@]^'L>"R3| =gu֢bP Dz /\ox eC}#2|EV\ $M] B.,Z,<<'6KC_nĭ2Pfs;H<~8U'RUM.b7}JBg mv]L<:ps }JeΡw~ԓjsH,*dV̒ c3 32Nzl}YjihH ǁ\㑴 GQfUv'$MBݲC|,Ȍ7?=fPp(MجeTbV1ӨΗNq3MJA-dnJ(`'umб_7Cs[t~3>oXۭ85~1̦E BROLLHQJ:iN)XA"V ro @>%M= Ylje F(ig>J<" 1/sCVo8MӵZw<- ě/;%\N?^D846e6MYv6Gb=jCa{7;/- H1OO)wfhm3qq\:/C}p3/qY=y2-Jum wF8U6Ʃf0uv&GwvO63mMڀV!Nr&WSoQΤ݇ψ(bԓGs-ghr_s,8J7u*`+VoVxL7^-^o)k02%~/ `/4={~Z!iQq>T4ˉ3!}Ԑ%!{oՔ%jF_ :V)?^M94 տ3 Q{'l:#;dk @q{sԞѝi8T5@9DQq?Tص>ӨSjr ϡjrܵ9O{OeR?3[hMċPFE6,H3գogժx3e}ݬFq˸ Yww|s=Çj!cjUվȆ}6\Gt,G֝ZF PLN`Yedu9m&Voh n/|iFAvVzmӺg )h)oGZ~ߧSzGou38& X}oX倞w#4j˅b o햪ĀdV[N{0HB:4O\b詌֌hKIr;4\U 7īs1zezmƩza>[+ſ嘛,֩Q9md2 ?;#>#\qjħF樑*X.jbiH5kfBǠz @iU DUf>(B7䩨S_Zu/<*iT[Ey yDWY땓e']7ǽ(\ 9= Zmх4 ȧG#6ebfxfX#|V/.;ER6X[D)B?EbX_˺]oӶ5@V Z$ԫسJ^ AY"|5$Lө+ m %Բ1LҢgG>Wu`uW`Z#` |C̣J5<-7 uNUMzʭttzȓy1fLE#'hV 1dEv *Zυ[3;vvcS Q/SвqgtC'$̓H0tA +ȊOO%^v0[;@e ZtqDlz ϬNւ!xA̬OQ.PL3bOs'/:rtՀ>D6J{thC]T;F&`ԥܘRe7-|ԕCHF"sAšgl6mI6%M-D =7y68؈T#ʛqوfݍZ?=XYY[!݀;Ϩ*YsWB~owVOUq &h"CTQOJ?WGj]52j?!1Ɲ`FjfSm!0-E G$4!^ 'kJp~$RH mZ|\mR]d"d쫤$uiH|ij3zˣ1hrJ y:ju+eSZxR- QjZoWrmCt)WQ4Iٸ؛_rLA oHMЯW[jvi1V8(v]<7nbS9jO Σ !Iygy2i*en#UB+c _jV^4# Z֮bԘ#CFepE:).4v=%迬9č$Vٕa SHYc5Ρ^ko!RU֫UyAǁ: /n\Z(NWk5 {0 *?qw|?9uz' lM,f{KԻ:\#bcgZ͘/Y3(jz7Pca^*̲ UpoWY}zSŽC5N^8]s#s<ϺbU br]wɃdDc4$}vW4v/jW5+腟KZB '.{-qsR0S9DV9.c8 Kޓlxj-~q~XzCR?3`rTtr.]3U-fjS'9'0.?]-9 D?_:Ӡ݆%FCX ay,FJ*P Mqh.J*Kd /M2G<&~z%2/{xnOWP^ya{,b5SŪ$K@on0wVGՑgn<!U:N7zᠫ|zn, 0:r ՑGWv~OWG`ފݑcl7dǚԱ9βwԹ ԥEs7SbF@rBMZZӦ*ɚ+ B_( y@.˓zx\8ā| mNӆ{- &7VV1$YT'$͔@JAL>6Nk~UPJc lDGT|5 P~<ŮtkH<-;!AhV3C^/'A}L ⼟$Ehd#^q.Dly. JԨKMO6 f(9N{y9fX >d-]0 F֗04C4)eIps. Y) e'!wO|~dvyyHX1Nq6{ ^)z0Jd20^9vģi>:R~EK[#ԖuYk^nawpqYS> Pq :d`EqMS|XFW#"5"X: "!fr,@/:J*+++Y;Ԡ~bM),#6R#r UIsJ[xIS5r~)]ChZfך4s(:}wa0S,ݮy3v K#ԧ@t{ < fx^ˇ7ҋEָ@g2@ռm=;~&CHjT G 9Z=m{FC RATPy z]+ː;$qM2M?pviamL~+NgUK5&>>ah$;iե)IGL>Ęٝ{R3Sp1;ů=z3<{X Ջf&dhh}n .uF-`G[䢽o,s#30~4r/3&3Y*D т̐e<5(L\!+]OC׻V颌.et l[|F HZ',HGX2Cs6]n['&Q S| V2Iɬ_kGFnoaȩHFۗ?AIgތPS> to&7ZZqAϮWقoHGʈ$l~C _omgsI@<^69D6nɹ\ rr?⺡[*5YFRstYj'#),`<à|\7x]k!\WxqOYJ G x: 6B }lﯴtq^>/n3aqoO9zlGzS8l_7 G$*~e̳8>ZiaF?z'n^ew]#_`.8^+qC̮j6_|܂i;ćĠzWi O3𔓠'.3jOjL6~u58͗7âKJ]1g _h\ ;Qfgћp~HOЕ~l^ʳ6jD<ߔ>+U | %P8r~sDph6 F3MBhF>[?D!+"'mlڌƞuzH,Ǻy} 4'){f{CA!!5u !"$W'q[OSvzt/˒cNtq! XFv.Ϻ#qZ7}ub?%oLVil76gQ__X%PdA[jgk­z[\O߀dv:ցGe?mn{7 xEeռiEVߧ66h-87;Qâ9V<H{B[yɤpZuD[A ֎Scs+S.HE9"nYwV2 T(A'y:gJMbW,py?'Y;`#/4#)uņUmfP|I[c?t/Z)#3>> oBFS!ϠufiԦE'S2O$ZWL)_ioZl>:=ƸwJ_xκn~n~?9ÜxuL+d YH|1]fGcHI8cVh7h?mԕJÅ(7ę6|w/mvf \wʰ`۴I AULJJnkD/z`}ɍDc&moG*į ]5%[rOOħ3y5gُ5r؃;bI-اWnUddTM//Zŕ2m4$%?\m+fQ^hdd|@qa晷G47ynn. G[ue~,dx62>eǰxkFc*W,lVN5iSyu^ȿO}A?!{{ô&CS{ HMS̓9|c[Ǽ|H-%V^ay -{^V!oNe>Y{w9]%f4%K١=pZs,>6)LSҵڢeYSwJtڑ]^ʦm::XgiW{FPçMZ5/XG!tZ@]ڭ H9`>3]Urhxsz:(kBSjJ$j4K9 G_p>فYWrh0 XcO$u_\7=2=O?\k%n ",Mh$+<3c hRsD{[sǘS'.)숸C{Bd>Krɡ䱰$@ٴEfn*2#Hm/*KA1D DÆ@*R\4D>~0@|eHWe'bPNw_+ЗK'b^ia(%Zis?4#0߶8er?̔ҷ[-8BՠFD jkOc Y5EwX,߄>B!nqK1Ŀ$ȩa)ťQLsq0 ^XB;rf<ǡ^?N:,u^x=ja® `#8<:!z/tgJMLCK xTյ7>$$Bh`M bb0PI!BmNZucMbp0hh^[Ek}U!M/6 (RڻFyos&k!asz<- j5T{%,98.XյSXՋ-lq Q'Cuz_B7wp)3vuAk%5tO\7JɎWgvՈ[ d|[,t6 q0{Դ=ԛ K{Hz}Dr klu% 5h5Y󸵪{L˜|b"GK6c43oDF(|[};UH, ^%;Dz-3qTfA.ݣhmP<~zb;t'qDJ9Dmv+jFdAPX;Dma]7q-mu/C6\UkH߼w8ĘQ&y$3cewTN^> */oV|EOF'fNw;5, <3ߏ  n0f䢂I׷"0=^fzDk q%کaX~dvp6M"1u수/} .P==n)VuǛW;_8?eE<oXЙ-`aiNnTM/,X??.c龾^L=Vĉgd%OņM}y($ޜa /`6(ѵJc[[nNEc[#p_㫌ĭEu60Gm1.1yǭ1r{gw pd}rYĸ" YmDymq0O]O+&57őatl[i5R"(F]|qH"Nk*FGk6R ڨ}2%,q/MHAC]4h`C؟J yt+mP`4?_6ڗܼHmO >9O pKt$uDoZ{:[ ̀)mշm=b)Cޠ5bkVh 'X,oJnͧ-7_l~{4 XiIl;4U)z6\4NѽV;Y XBg4x:Z!QmG+ G "r% Fn~/rbBIeiC"딎zalج+}Vg|k_Ӄ*cDk { 6 ٍ0Xo=7ξ6:5|-7ާYerܳ 7yyֹ A+#3XԴhe\E/j3q7\DOvS'.i~(=S l}me+rlɵeV4M2>ᣫƁq4]~Zh,l`|b΅;4Gu/4{}B]t=m]=bZhږ$S1 ߍd +CHX8my)EF..XZA& -ڍwaK{`%liZ|NYś!Xa[2eS넟 gVq->],l~Ź!.u4gZőxNJĂDIs ӊ+ܐ?%:7[c_l8ʼnڵQ~CX^uL|c)Y%ri3}# u񫨜QS#1)~a 7-mk<ݺVmmx g/|gTG]d"49arj0*rd"nպla˃Ր~gV,J{x11[>n'NtE5F/5~:og8>E4\Uhl>G_=uŽASu A{}%Cajq?_>^$vEߥMR9B97/+J`) #4} &]I%4ugl"?+>z-tsh Rz|eؕwЖ^V}H^D~֎FQ]ꖷ,X^ Q;|G[n-n5- RR(oZMya<$:A]h#? skD_ZgzZZ%U.1D>7/hqHzA#z)ljr˙͊u@[`fᜩaIݩw؜[].[ӌLWUfX|9"5;py zvEf۫ԳFybhh%}7>UҾM)ˁdzs)'R|eS wUm,v&Um+ⶣ^b^`Sa@\@$~Um\Kyww5+&j&!lSnTMOZRhUd|7Ojܛ[#vVqlo6:~0t݁SOUl>c$7Qˇl^g&On{Qe!Ev/gд]C4h y6)қvSV_FL&jhR\Gx՞>%.L`z_n-7W5LS޽sjo7%<`&6t^#YuՑ>h}zf-qI &7Ui?`x7ҁ(| ބR&9_Yd!Y` Xnm;]I۵vZJgCǎTf"z9 ާ8Wށ0zѺWĊo@^QW ܳ+}%,)FɟB !:'.Zd-"W6Le]Mn%8ħKO1hUlĦZ_5"`?&t@VRo OÞrH%|\ U&5TYZ;/}2K"/D3>jd0U)?-QT]q|g=s"Y!)T^HItU $M~mƽ_tV8aS8=C#SB G i{]㯌D+zhp퍯@ @h9X.!CwFJZdAgLɗ2]LJc7$GŨ` #SP< 7ț1{/ʑa1Bp6޷>$?^WU+ sy>wQ9ݛy{@oC܃20޹-ʆ}tF5h-0]?%GϘO01TMϝRztPYv͠QW (5l6')ET~x``?AOa Cù]7e%gRE$}%gC5C)z$pPV*U1uD73zkMOӝ KvkʈeP % ɲп>2c⑮.zIcTEp;݌ Ym;BsS'"U@ G!(Ђ-"3d e 7S R+F([%`Je.a>Bcl4wA4$2b5~1oW v0nvmxвz0!$їdW%FUdLU٪_#78sVϾ0&URbJ?U=~Ztk]_л^2"^odC{en!3OtG*gЈ3 :Rt ԋFЋ!lBEI(##&G:q7$>biI&Ś$P<Z/R[ѱ#ΰk0 {C .[ܭ aGɿ wki4n4mwlFY'Zt}Vq|ᙘ+p^0J=8kFƦujȚ38>l*K $X.saCKZЯIԕ5SC27cT19k~1/wjm+v6!+o%fcd~<4UK{##s!:ŵ uZa=ÒK =Z!]/Hb7~_OFuA\yJ7C rm۹cb21 ^7Lx,ֳ;b b^'橱둪MђjmB{uu$JzDilK4'T/cu=)4PLhL:* &w1 :s\|4/ `2,M|Q!m+Vq' 728k 8=Bkֹ]'RAHL3V7ŅYM;, lVdN09x%:,ںA{/&R'`%n,q" >oPY ^mj4iOҙ#~¿,ЦnJo:Y(MT*y,kᯈ?ZjȨ+*'g!#j6C͆S̆=Ŏy̆K7̆xJFFZ&Dcu8VϘcX=͂xVr=jNi~#Ikay&fU`;ÄdRlAoBUieƛ{,ڻ>,9Ki)]_Oۈ:-KN8eX/_Pvﷶ%pp[׫,2T  ./l(ɼMёB`U"X$^$](.sAqKnTq޷cY#\#\{ةf"c[`^^5AO4zbun܌qqg5Q$!uQCMjoa}ji0 2SΦKyBH|}Rxa6p6 +^qKL{cW/&dOxskyIB4)bfv ̇Nw>ɸk2Eni=a?ԙǧ]H/fjv.m~7hqO@ONQiü)f\ҧŰw`>A' _`3y"+KdI(Pvjֱ,xn#-K=軾gt nIsw*/G-j7s浠b&3" eαвXb[[ a59āu 鶳i U.G, 4ȏhD ULۢK P4H>OHw8@܃Q'k`@{S܈L+l:l7{2cE]4Ʀ{nnFC~i=lS}C6FS15mn71CRzlx{\->mD' J2J /G藊3,7Pf;:t9Lim6NNI65|_^Cڃw71QA SpZApyy|!{vGKzs4fδBZ>vo oȝg%gY;y?bOӦo+?KRĸ39fugn$>rO}Jy# NfsoZ]P"tt)BmC*Fj-Q{W2+8dc0[6n^`oP OЪBT:fJ?5苕r?Ð͵FG3W#\"c5'*"ho 2)[ٻ.0I.<хI [|S[a@5I ~PM-+ZT#V1lh=LqD9ςnwzC/¶e8D:JDكgΪp|>xf|?nbG;#C1SRumn(1HL. ꆶeN }hCU!ouWDZ@*qzyͺ <{i -ʦo為DZie@ŕ (߈b>k/ n+/g7H򜱑 ZZŕFEL߯ky99|vky*EY)]6rlj/[:L.uK;TtX#`Q&U}[|%ĥ_CV}vtkKp9k혗g\m6q0+zjZ{[{%;kn5Ϫep[m}zށfUi茜((3MzAB{U+VA;{]Ө|*SĨi?@}ZM{bQ'uY6NSm'l8cev=VVIuݬK2 &ӏA`2=v$]*R>1A`y,7ȗP6*o\s,\ ɷ &!+7m&>/pv@%Φ^4ǘ8tY59@;_F7RWi İD}v@>ǚ1)-Iu$y̆hߌHFOL"nl߹ c-mDO]iK%_ژJg*I>χqQEb'2 Nd"&guU mMl[ka:U17>oc.9k '"ҕPoW=4Ŭ2}vA h5  RJyKK2o&adzK̛ż)\/aMڑV;,s t-UА$U=#J%U.NHU@t*&oHUED$U탤겿T [BD-9.k=N稈_ q)FuKG#x%q3_aa.E( 'F2+Cʭֺ͑G9Z|PBkߒ7lqk_3îJ/ {j?-\!?.z@FE/;"xc%ZI '7X+B7Cj_-1|Z9}QR?}%tXcLBc0+SN\|Ȗ&Vbe3n&8>A4ZWWZ$!ꈬ$tO^>B;$a9 OFāWK05*\凞E@Qʢ')|޺m ?(zȁ[" UCab>IdӺ7,̶(IպhLÕ:-}^ɩs8h7x "󑈄ZV*Z BZ:sL@|`ha u0UsN_1A$K|ZYV.g<%0KpUXPK5\IgQU@BuʆG/2GMQ#zqN6c8XO3iROM6,ә@ߚ*o ytt9ؼ@m&DC7Ω#OBsp).if _\Iص#ښ|)@"p+kש~Jw"]4G3;؋&[,',@r7jyj K{>zu ч(1Sٓ@׷Wk+(UΒEt薗+UV(f"C \hoᙆyw\A%,'16EM~ƌg OJhƕ u :@ bEy)Etd%@Mô*lᢤ~>QV <3 ݣXw*gT月*qYՙ.",n/ȨfVA\.,㴒lZJrb+-w5Q}%>nJK}\Ku[.zC`Ғ,zlC͇}4`>CD.qGz|Nv[T% gcfی*I=G8;lms'C决p'u9k_\6ΰ̅Lxl\n6y׶.Gy|X~41nBkOfq 2Kl_`Ph47n-~=C?V I$Or#vHgwٌ!FSc;pw 5?-9=rq@Nqoֆ\k򫺯-`2vwz8;>;nV<8DF-xFDCq6?RX̕H &V0S-YƝf䃁Pӏ3]A(tcD2K#D$af}A~qXM ]*3*_`X)dY"ap/mἜ;F&>vЍ2iUxַdvwBXfrvٕ)lPԖ״OZΐH6\< y֣i#ZxhFڒMyZfz8V&j*ךZzqm[30Xغ0)CFIm场eISnQk w9wR~;ܵD"šlلX}wh8m'c ߼?#5:dz~\'BWtAnZ:]d-! =6nt V HB|NcKcv\;47LYێ4F# *Z[F(R9NvJr#|}nZvLAh /U±oTo߫*JTS~]zgr\7@,V榝:t熝  5%b8jSXjg6u7S<|<=Zv׵fVT|@#6k@Z6& k0 ӣxK Y@ɥqeX!C`c u>#jH7|pQމ2A l UKӪFaa Z 28A~rp?Mfz!` f? 7ˈIT$F̹GŽKc O%zY]#vPff6pUC ֿ立X-CEvуj=F &D)OG UmG :dA?A`<R|if/ʠ~y {1Ka+ ՟K6N1m__┱䴌:=:updT+ok%E-٠ B&2߬GڷZ269e}K-jy= !w4X[kq\ Lnjm'\/-EUIؾi} JEY+̀OvN7y*E}_/؂a9/_.ոz;Pnx;5/ST./ RwǺ{ mV~ZҶ=&lҫ.hav.ѷq'PFv@=:"Z%1 h׍S#w鉟l&MM1xT@$ZaҚy`ʫ+i,: 6A GӇhVW@tw) Jķ1XVQ_D"l0G;oozG]<8Fqw~NUhaQz5s7M[xHG1UD']D! v7}XNN@5/q6j%:UnKFz} JåZ&" Dh¤UJvi8 Vnl1!U@JFjٗgh9|vؿG sKQX0Öخ9!T/F'}%nV$ I7=!n¾&}lfFÀ+Cx`FW$7Nk%ސ =`>e~6y~aūs-0p\ F/"o0 ˍhiڮ]]iǟ)}FZyԼ[46.8H,^ҭulJ{$>CoN׹AЁ3a R{ =,(2 rW3Qȋa|OiWc/i^QeqeKlz uW'a%Ae c0;hKVӏ9}.\z`^{Vbz2Vҭ)ZIZBxS;T8dfp"1B"PMEa{NMQk s{ !b`s٭IzJ ,b$0-}YwF)f4bFM {2ڊ/eȭ8x8DaG!32Αrr̹[sU5Οb|waG5tP9# B4n"[+1ZĂ^ }?/Ϯ)D~@$KHM8Ix'H,mapVB`]vhzQyP+PyC\Ey),M SIY)g>wd;eJ #l9 m[WWs P]j[Pv ծ-fKjEZ1R^A{+`Bi3`b8Dv"UOAMq\e`N00w= @dθI0 ģ/h$]4V,\,ub\@RWX'K1ǟ OR,mC6$O6O.>J'Kg$ G[#V]T틴]`u[$>$/;-O1g> i%(x 7fwջ=Tzu*8sC?F;13aBؖl?S#fha V6e&2w4:.:--V>%g)Yuo`1%ˍx% 'J]oAg=|`qE*Ѫ4NA#ӎżJ*umn/sD+ȩV~hMYATkimSN-@p.ޅ%aw@4tSX%/V}+:|Kbp`a&6)NG1xIV ]O8n>tuݮoWƟG䊚iiܷjP!Q'dsӰ$BH-JjIVQ[067qY( I!! toJҸq` ;`Ǣns*J0^ !"͐cp KG;@CK |Օ0>O! qQRktF`@2DLL>&A v"t!l\w]mw뾶Ek a!s3 ֟as?=s=si%kkFaU, ,WHMy*@ ZFRwA RAOm86HDz6N\(>ݐ",.P)'+->s?0k' MeeBl{6ӔS)z#AG7o#G84;ܐ -p4Nu$ߌO*?zJ jyRRkt݂2O(Fj*$- :cCnNxWrTgU @_vKx|\QQ侀_q%ZNƔbj(v W~m31;eܢl[CnrqLHfQ=Q2CICe,YaP籜d k&MX6Իo{TaivX8>5u8+)/ਫUZJ\l5UHO Ǹhjx;2㩠IZTrk16>68d %+z.?W;Fq  Y]q3 ypsAVOǔɻ@&  I= 4O&va˦(=lbxL-31lA 媄ec4@a`s56fR3Ox2Y5uzL[atxI3:u:550*(ewBa2 zd*W2}?ClҢ_Z\d<^5^Zd856Yle]zdzXѡW#*A]^-wrwg򐲙Rw>M",J5Ycv LgөKĻVf"Zۨ;vZbRF]Fn]yI k3c7tx O/^VVV`=[?\w dZ/*eC۳<X6|bzc0r;IafHE)4m5M @x2;J:y= ڿ$|O>Ԃ3SdGy|݈Ӫno{e:O!yv,ޓ4Ep1Qv@U JH$ \ܬ='y}6y5C:(ĄU)S@lFqnQomiɵRt_[MFQA< 3ʖ6~;Z{>`n$BLLrG9{&TX& ūۂyR(bܬ{jVcʆgIi:.oH&5p>V'f+ESm\HY&dg1rh``׃f̈́[bgP2eQ` PC@QQW SJYI :]vX>+]]jvM6wVñ̽[Zv#\iwt),NCP}UУ{zJvwj0R\+M\9tMTf#sR{!cHonGg'5V--D/b\M;ٺ 3ږ8K_̠]: ^!+fd*JF(YQy7[r 椩\~v~|V#^<>8-M,d6į%Hʰ:huH6\ZpUds"%wV] f&HoEr  ZgiTUY#"11ڐѥPI blҕrʌ(*QX7peVҳBSpR@v2P7dؚǯo;ҍš^X,ѐ` ({ڸW[ZyT)}bh!mg64o$Dn0 /O] aּ hX)4s*OQ\]58ԼKdfɕqоnu1f~!&_ڼ];`dПy ) *Gn0#-qM?#Miukm WB+;nP^gkltpN|J q7 ]=h}aAm?~m94IHxWҙkr'bmW׋!|#M0 VllE!A4vLФ)%*D6OVkl[j=cS֭FBIqb'v#y\~9㔓ַ~9eIIDSB.RêWQ)޷nMu[1ANe@#pFO63{a3fίnu~ù> ]2Ь>Rkyu:_y[ؑ PJEg)SKƝ@usڡ?U|L*JpۈYNٽs"DiS%z$ynyMD?(JŚ" [pzjcW9xִ4r2S?HkM%ʆVTWLB})ِ&ڻd>L$' y*<:yDX>ڇrXVL/:'Ip3Lov|ZcjbߗAW/-~ ^R?X=1LB;FtkÐ͜$_%_oc{4Bn*۸o'53ԅZCk>I|G|& O`=wCi/߉,ߟ")5)va)Ǵӭ&rBT]1=ɏO@xy #AbG=h&#I<1Z[ Hr!"((j {W$Th;z =<_e|g(b}"?椥E7LBӬ0B7v Y?b"z"[z.Wr㍏ f0e՜>?*`m왯C{m5&ׁ3h O`֛9,%g2p UN(xS͙ԯA#}7|VQ0XhǬ2vC/ZA܅;5ni֚y|mPoyP!2 ~4&R:eZBgԭqR ɺƖʪ]AVuV?P`h1]~T? ɫN5MMG|1kg?}\@pyjQe0+\k.7RI8[^>i]Y{".\Wɛޥ+u4-ӔEnkvthd %|L$q. D,/.\vWƥzA/ӡY٘5u X !7, 9ôccJq/-\ϐH:7ՎRt!=ռ T:\J5T/;&i%]e;rPR X#gS=ڎfҋ* MI~ez\ݡoƙ@x+ mLl8U4͐n(;Ɔ5W1 uobPV xsËp~ecw&Qe \׃j~,𬲡}!l160Ct$ywQnJfT4emH]&ZхH.JKբ\myج*2p䱽lQoZ䯳l~FOSD*ǫtzNz:L2i !^_X:Ds}UL80W`cC#3JjPrOz[\? ͣ:ئ gnjr[M y}-ȽwI]UNJnG.|VG()GF vpkN=>5 46m x9urQ wsa㱟̷>Zyg LX7Aߢ'yh Z;`޾ MIG`sgT^7]st3t(\S]w*ݾqC glNj"zM< z3>CA}⡷ڦ9۪ *]G^&U7Yn“ySFu(>#-HS=$ޜEZIqiwk9 @]0HkYI;l糓{zacdHBÁ$_C'`SR"!Zh]i~R ]lCٶmC9#Do O0tHV$9ILE=Ԏ,nRMs- Z -}ܑ5t?2G |yE^ji tur~6\ϥ,6錁X>cMt^a<q}tW-9O{M޶9dA3ٸ[T_вE@L8C 2gu 0e˔?DeJX?DeJ>Dd-O)a˔ y}d3h5iK..m,-^چ'^\ԚYt캁J>PŅ8R_x:l2e}gZ~YbfP~o^i9aКމ&SLG1?oȌJL\:`՗GGVL}2M/JUWUQUxoPOe[28%g,}e dQ_2|Qs+5WEͽ}抾_Bs%_×iK qF-]/jӳLK qĚ~ $ mO={r}A岻r({r\.1^u^tëSд"Xy*+i/F"wcaOq}\#S2LrV5PS%>MjOuW9;Q,Gw"g5|7o-ӕ@,e,]1gŝIW[:88Xfb}tY%r-h?|6R|Af'dku{T/CQZ_Sϩu~bfRq}Y*޾l>"Nn9xM0K$r6:~k?+~n_B4(/nrTctr 0PhR8Jsi@+R5ˍJ*R %sx]ΠS~̣V# O?pOÿѬ'꧉eoV6=V 9G7b.?)$f7"oDoPlt ]1rն4LoDY)7c Ȍ-LcIy$B+JDyIXaB&5W{iW,D |mrл0F<=o'!Ǽ0O8Gt9.w%E+KJ#?-F)K[(q 5Фc=GM fl**ayO݀z^,1H-]oؘy;|BB=WCnz\=XRAOBzWtkq7nW YKcZ--5h  B%HVt=W X[߾{:V͐)|z/J9DCŸ'x$gs u4s񞉯cD~"W :{+f+HF1* v6T4-7CݷO XzD|و8qF.^)f١6eQ?#:D,q(`tHgu&$" >GJd4W1FV#@sd^4H# `:;3TJW $}:pw )k|C_0N0%\؏8E!4uWkF,e`eh9]ԣ\ehtvм]<4Le ,fKCH<;ަ}~28' ǖg4> 3eBG1dPڗ<{c4:Vס]tZG~yҧەLZǿSs:ey&<>k<' 1:Q3#;#߹+pz {~3oFۘLϕ&dJ95&ӎ=z,N _}5{ɇU]BgI7-5@za踂kqaWE?M2ЮzOt?`dUV8مhzԄ8shL4,ˋ&<=EoDDMI<3Y$>YJQ25?`:s= GZt9{2`b/|t`/WO, ~_|p14 n<.,QZ v+.ll%pubJђzu.*"$'D3aE)<7^)nfU"[oeJϊ`Y_5~oٴ/(͉Y很}yoxִ?/5;eAԑ ٝ~)l:7?G{stZ,*v?WhѲnJ ed?Eb 3ꑥl9b0L凯!7`  F >jƛa !F0c)| +  %+8gBnO(x QgĶk`?4:sX)L~ǠJ`Y4;1 BsD$yGB#@ @qDh@;?Km =4W1o10Ys0EЖZzQ).o)"}u8!_RiS?EiWB:6ܵ(*<z 7{'C?T~‘f> ~{} Qg}88,k>@İ9A 07[J&>O}hiGQW&jo$8Sه:!:L pLD^D8VlE{b%  vY¨5Z5l&|F@/FwE^Fo/J SM 4G]T }#N -V"+j ңĽ!v,-lZ^-űyL)#1ve^tH,`1RJ8c3P(Ŝs$3'AT%Zy$ heOQv.꣋%/uǢ-"-Iu x~ AhC5w& 3dDL\B+e x̡ǐ>{?[l57$-ۦO5.l&G9dL/pMaãՈ8v$ lV:qRh!wFNT1{4'gK 1)+^r00]HPH@Kt9'<97 @hʧP-a]uu ^WkLJԙB|z%~3zA4{H"}ֳ9ozmޤw7wrn÷J>I:f vEZ jc:^^VgBVX+-i` v} B &+҅B~l43a " 94Pi!R |qf1i) 17/uWhobWVK,όy wvx78F' >|vլ7GQ[YgsuIC_BVb/P`^Xh9 l-,ŃK' oRf/>QQϡbX;fHVIQY)*ߥRTDeɳ̻Lk=[3ݣ~12̞ʣt(+~_עl>(M<^{J|j0Wp!>%ͽcv5g"r~}ۘv_Ħ 3Tl{JeܚDhhN-۬ԙi x]=:8nffQz5 jyc{'_UיQ0 ."FX!/dR ؈"LsB\XcBrFX.=GyсPA50}QU VHG]PiяƔYHGm7Ly{KDą =wLO69tYɟ~ @w!"bƍ/aN 3Z&0*M oh{20WCv~i8Ƒ!XnqiuY6M[+S S`~B%0ǨX aq]3v 1qEEqZD#N*K IH6d2 X+8>S?z9eUUVBQM_q!MDТq8tE~~&!+)"Ɗɢ"ca>ox<wfiH RkGvh/GZ8

h܃prt( wi7tsA4H4*!اHb tSr<[0쭇;XlRb4&HN EWB_ykR8 <{'vCƾ$>d#;h|35 m>nBƏY7ʿ<5`"]kٸEfqXVO'PTBL ,`XrݟϔEz(@uJq"ߎV}+r(hm gσ X{v[k=t-XBc#e`OC 4jBÃxLcBd#I [lfm"PTmyf8 o 1 :OTq%A~DW, _$5Rk+RAI —^SZj0eJ 3..oῈ %,8Ҽ_VjN YK RK _v>6|5[=SJ,Iu%7tNnCdX|Zqo;A}~ԓHJqq=?B3;Q`bᣦ ҄g0]OzǢaFTOH緡\4Q5&\mC"tPdF67eD{t@$eaz9t,e4}D yU`uG;6u fWGO)OR IE/޳:w| 9:Xq2zyq1(=Yaih52W1 μtр!E(E@φcba=ؔ?$nK! [ã6UGxqZ£~sub|Grĭj8.S놿zpLB:ή3-DְO::w'o;t.`KL L_iz2}*+blprVy5@\TĵJC%@ABON:;s'kZǟ ߟ|FhCmJAӡzO&8~WrmI҄^^(7lVk.i-zm_n; ms0stU gAϡ-YOF+/9I) z\|X':l̟;;yG(CB>sMyUƻ ƺ. O)2 .UCJQ^DUy|*2!3:wSt>TD@ r>Ⅾ}24*,΅. 57dv?Os8#p4q&w4a8C֫7Qj5[jBI3[vFכFoXؘęm=&*kt6tqE%o=s"ނqӟgtg&"]xLRm]Pm{YE k:n g{`<}+i\!V&W|!WrE\Q"WYHW㰇r=*&:C2p/2~u?J]!kEVdUfhd-ͬӮ,妄\5Ϊ1D!t\*^-$7S NW _mkOFCe#rUDl7@9b): щExSCj~J}Jleu\.Lt M1#kz$-Vo$/cBd(}W L]pp;\)>;k\+j) [}st_ݐde:5=6ںgMi R xSkS6iwuB=Txl*BT+L1 P PaJ]>ktP.xY)e*ތqÎ|VTS]۫:%ת[`Mq#r87TX˵c,(4F\M 'hDZCjGȠF2!eb.)˖'{R1sTOҳJazI(_h2IhJ(>T0IVK1 $ePXss382a~#/ұ8r1Ot<^a! U) -%j@x VRZ!7LJqa%KMf剛yne,4"|}TaG~͡)\eՎ>628381q~wksœѻ9œ7e0|7k$*_fB)͋ |bj߈yTV a! ZkX>cnp7k_BvF+K2`H%p1\i jJRcp1*&0^AWZoa}؇k49*jP.Fvk]): įpF քl9іux`4[1f0 FKվ%3#SCf'R!1\,)q}s{79zLw4}~`r;jHGhy6ASy|w6E=_e>=hėQ'G] ck<RL5J8CK} tו$*p:NĝV%q[h5 K-EbYE#d!n')ʏ237d3N&Nٓd$N@?`~c,LdJ`;H[?v1砮Ww{2VKr[ PQ@:Na u|^>h/^@(ס>n@Jۢw:܍],mkv7e4%c-t|mA=.u:6l#G9P)!N[z?Lޅ|bޱż \ʜw+*Dz¥s~,yoֈn,%\<0mӳ5z['3Fd gk3$3ߧFFJB0*a A=P!GLvq܇YO'f !״߬p1Cґ 7ٚ V CyB"jjo0|)s_3t^2KC.eWDoɒ bTr|=.IVMNɫx|F:r0<i(PLnCDϬ;Hϰ^[d*kq%WKJmxQ7)0bgk^{Ǣ3!We#J˺ګyHt@Fi<ϳa2~Z'1K[eܡ%l`(#;j* o霊rbbo$Q"t.odHԁ푀q6xGB\KOfW"XPy$d8DORAؒFƊI$Ȕ[(z<%osˌ >hUO,-F(if{s0)6>OXIHUˮh؞5\Oԇ/Q:T>~z!ZGƠ@,\f{Raחźmx;FXX'du=P<~.|hX`9$BiC y{uk?+zdnr\sQ[cDN%Ї/KЅ6Z^JU ꥃ5UPK7qP6Ѹ-l值p٫_$YgECՄegi(d`siK|u>[!UM=޿r$ oAH|Q <*=+m$0V[l{Al"7BYC5Q~n_sW] $h'ODSx1ōH'bmNjcbmNjoezr&qK/i6uK,zZYVq)Qs׽4([6Bn^yu@0r;0yK 9r^gA4n9!NHUj2nz@en$]߲Unѫؚ!tXH_ݳպ ]XjWq[-e ؜Cx%k6yO0zy`2yA5y #VlCt`o6ȝB*wn|Xzn9-U?P+~243fMj``G;6taOT _r9uIzzPՃ8uc}[[bgzmqk2[ |A @Qѓ"MTCMkI5OxeFyCN\muȒƃ)F;>M- $.:by> 4T0!=*,ԮJqGm` L̄C]ѫl.e%os'_?19ZS=yCs]&pF _ eM|&eɫ+Eҙw![^i̛x:O}t!kSwz?xw:a!ًZ8=)+Ao]O}IvȋK6_zqϘ࣡*]/I|{} j)-oP8/K 6o1ͫJJoȞiʕ 堟VzhҞ|R;K^vx${vp x@܋]jNŮMƖz)ڵFG q|äݫt?^{ ;Etj$oWߵ\f\)`/p*ᆱ'o8qF8 3 ЃEz% #8uCSB}Ft!4HpR"g%G_O1[/5%Dž^ sxWbJ<6@+y G!7'αDրGbiJ뇢ҫo  Xq7w! `|x1tu0Q z^ackJ/Ngyv6@GhsniգVު(sszQ`֝z~T>7s*=NN+ϖ|>%VLbDi OVje^d{z ;0'R{1d(ϾH=K𠓕%~7lw : DȽvFc5{$CFzhh0b i큹 U@ ;o>Zcb]dae/__R76*NkI++~OqZa}#IytwAG+GUp1)ӢB*(m<ӏ񸊻R9h_w? E w3p:=$=c:"CWwq# Vfw,Sz3Ev[{0*u2hxz\hҪOhQ.0cdebEgfn`eRtv3^g+p1{ss5[2P,J#pT봆lxhڠ=xx%@![[!r(>Nlkv3b6Xgؤ [ȵ2O[as%g,~s+:rҞiEEq S0M͞  aAa/qr4#p$B{ʄA`a |1zD0!#.0c&sZ##jЯ 3du Y;0,&WYld-4(zI^$8Ol(Tf O)F+)b'`X%q: ]19 ^.E{8qpƸNTȭ*X9Lń TS͟ `{%veZҭ uր" j=sאվFқ]U :-%O?\JGh7d-+r`&j D̿bXYF_+>bl0 +1b#K!Ca!7\^V㞣)Q-uFt#<ΐ{ W29K:c[.ouPب4]3 Z?aQcDNGxwnh܇5N7won|;@=%h5^}<&k/eK{C/џMMiV%܁ wf惁\6̑:.j5?eU4nl!Q3c1dN4Q=j4WX?nΜ ^bۼ֜1ᙫݡpO{#y9={-+F#y3Tz|LOfZvcTWAq~txF&|;Ů sci*F'_LRgÓvY3vZutsJZm[Кm[InRt2iCjeRkb^wV8ÛS'`)e'H}y*19`r/Y )@'b,U̎aM"UrfђX|hɬBYTVYyh9Yfr G*'oyTEl~f"&NXDP!ZDQ@,[|?)M b~U\:ac!ZQI  2菭"wr.*,hyJr%2Dhf3p4DM(}Eh3+;_1$2{@fDc,ZjQV? Ffet(5s*Q }ųJj0M]& n i`ک46Č7"}SpSHbd5|r{3w?߱StL>)-Yٲ݃|1{=¯!2VKhlCt[+J>;9%+ ·_nm 90[Kh/4_K4ȍ5J8񊤝{hc9u[Gv6Y6!"ۗ?fA0*P4DBp<6Y-nOގeHr.y~dO3]:_DRD)]DђrQDQD[5#[.wSSK| \`BYFOR>ݎEwT*kw^6];<*LeUd k8z"4D ΋_Sz%W8qJFJ.4jJXP:"xsUBe#fBEͯ\'hME/hkF@ K瑲|Rכus)2U$wdw=q|-kqWCN f)$ڠ+ _MBhĬAJT@ TBQj|p||ctMPs&!%9TQdp$ԞUo+&5_tXVxNܿK^'aѦ˥)݆ ;qK6cn#"҉Zx mhkJc5UX;mgܖ BwÒef%<_(mZiH,[)v ,JTx?nL0k^691mڑSd80W#t|LAJ\C-&6h#ϥ| Aߒv4~}'K)n'˪kmەkST %%W5h̏%UL G^J*SWzyB೻ acąXvn"1w0ƫ%`MNXȡߣS2< O^ ;agFd&'ɎxC€$'!|'Ax{ވ(|m#"k,ariZ1;N_sR &#0IbCW움3p%fGm 0zņ땽Yp6Zkx1R!CmvmvmvmVvmv٩;f ˺! 1NUwߏ]=:% ,w."Fۈ~:u_UM$C+6QDd$ <pMz-S&W )=mW* bCQٴm{)B.dg"!J_CORBݢBƈX  ,j}*01YBCmE],74q;]v zh 7rre!4X.p2n0>l WjG.,8O?Õ AZmp;/h#+_/R+JzR; _ྫU^^ÑTctt O8d(d,>B"0$ZoP4ݫ*+-׸ܽؓhS=H= oRgGwҬ_bsp;foȶɱBsBzL*+TrlMx6|&vdn]dx"Q4 sLOB[F/O9N]Nښn76J$;Uu*{O^bQ2t8QvE);avWڍ v}R8>4vaϲg89 ]g$-+/H>tX$wvΎdIA*\pbL:=~wރZOιM\(6&$K̥3nfPr=$c]d./|33ш!3?j&su՛9C;2;q33wuN3?L3w̝l=O+k]73sh$uypI835:Qt,H@u]7ŧ;ԛ)4sPΨيN(-Mu2 5v(8'y,O8C3׀;JX?Au`KY*t ¨*@je |VBg&6cx:"˃9.}}:6vfإ= Ӂ_&!ʿziI3;P<;naUF2FVT5YA{=°^p8'_O ]Np>aRm"+o噖8 dOu+˾s T|@@RƋ11;f;}Z8s<ΛB!8dyQvqw/l$(xp XWk/()hChEyIlCf+!SVѤɒOLac0M M:տpJ$cYIOLKS<@TsueЅF[wG [IH'uSR)\;[̂~*td@@Bx9Lq9#HfP2ѕ1q7@2>drd ]Й0|E;A帢pUӝy+RGDewhs :ofG!htxu&|s`V cMօIG?/X'IP-|rrJ %0ٖW qJ{!-v%B!Vs;ѕ0&qyBzUSsJs 8;z.d|X?܁n zh3#f wY)в j VWQ7 QFTaXHZ2FNB}́^+øMI^0@r!@ WUɻfS3z8k"e Yl`Ol|t59݂&q`ž~`ԧPX{X8" n2"m>qGosUAp}D^QsLmԗDYHOP;[ "nYH_ VyC-$Sj LBp=rb!15ZVn!GYSJ胪_("D+gEkV}ɳ~7ϒ2BP} VH;h ҝ_ޜι:U4 qgYLA<*ٍnd,G &<&y̽ ݐoPK\AO&tخ!3zi&źg(u:iN [AYޢWJI`LF]w>:H;DeAssd~= s!;(qu /2"fgM&"; ߋmҨfNH;ܯK ,*w zH?S T2*Q}}o87LmTh ahI"lGқ:0'ݦW׳H8ǑXTQrrˋw:t>pbZ k%ի!oIȹ$b gYD\_b3obPW%FeBL U|6wh}3UVK9 KRU7B?FmXe }ϣ7!NQt /D! U;RԟsuCSR| =uJ!^%ƪ$6X' h zqu!?Eqz Njf6Y;X}t]]^kvs|bl9zV/4OR=#!a<`͕A#A1Ե|P^%{lgʂbY κ !$""&l:nC*4Fuo H vvzkS#|6; 7UFgw.){P/+mY:ڡjZt-\$ ,Ԙ g1CDB`k]#dBPE$&?g];Qm[KjF,|ivĮ/XTl MCA\N9C0\߂Vh } q)Q^z'〝80H} pS>ZJy- c|->( $ki+F`"KYF~I?B.B +ƫ@hR. :O]Hh)yAcY])=JLpaÁs5~A ghAvEZH)_?` fRPPhكj̨!/vy2hٌV;AV;йA,=|'2M I*Ϸ@\F3i}IԷ`m̦Xǡhi*ucv3YH+9}r='W9=IyI'9Ns'̹Ϲ;˱n EF3;1U4Uz7 F3RB-?]}l;/:wI.Rp8P$i}dW ҥ@AXdo #"‡ mB(Rm@j⤐ᄖ.D81ޛ/;Կ;oξ}`kR`w]T< L#h; P||Dm˷pާ0Vxcu3B N۰T)ozP˶װm؀ԷsMpoy5;N|8(GMϺs[HSђIJS@O׹H~6Y[ywvD4 s.<n&g8) Pդ;7Lk5.cg" _:q}5wKq9^ws()0+o&k^=6-|ƪ7y犷Z W܂\Ur30ʣ㹚qE7H(PV[[NCzo&O f S7?rbe" G2BESrvW[В#B{~:]^xW:3Wv) {ԱbbB6!X+*vxlr7pi" U RU&$zR6M8Ԛ**xС#F|ok#ZR}"O OP6f/>#?K e8pIPjA̓6wfJJԡV%Y!I9~ rrNVsIvo1h¾ \~AG~e(~Y~M,JqP!DC]ED]@n;tS GMPq&'H>4E(x*.KwVSyEHaԋpV|YO*1;\8ESroTM!!ﭚ0fy["ua5؊[$l&\LNnjJIRЖZ nc'ƥ%; >pϤ̾ ,67-`m%xP&H(m)рOA<\b~~jaL p7N\t47i9lU V4D⑪jS+pT՟6OUIN(VWX>/_WM%KIj2_99rwmă^+Wh6~pp"" f|H> PKbcafy#pI?-:-iA&?KSd5<Ԛ./"C;1TscoD:Hx]'R^]I$4Tj9t'WA9I pRC6՛U\ I$UDN+HnNrWNʤED)몠4GOW_}Jo?qny-M5x%y{z.ٷmv=cv@snش/~{BaL/`LFB)L>[0 &dHn^ׂ9x2w}=Є:Inx]OE,܃8޴T8-uU[d |F (x=3_ujxV?E ā+!ǟ ƀ%~Fvy  N!8<9&~2 )ϫ?qRg(],ljl%rBkMD= t?YưܕZox|~7X]qeb¾+k-b?Zv$#M >3ŶuBur?P@npeHFYO^9sC#s[O5Bs]Ƥ2pÝS[ʵ!Xb聖;-YRG~{XKڑfR[1tz)0v \a^ε* PWu^,A 8#, ڽ^(=J́wJ̰ycxBw[8tRJ #EUb˗8^e6i\t~cɱ܉"#FF6K.ݣp܃o֝L=)ŽP|~\ەyBDڃq'Iq[*~<=Z2[1ȚYW bn5_6)NJC斠7og1I 5߾StL'^## 'w۟ꚽ sGIs{6XTY!lusX Gusz"x9v㺝 Oz=9wC U}\Xe/zU FYnu _9 )3dQ krmFxi7{Fk?^ih5V^RH2T1XU|9_KEtuy*U1QX|e4n]sU| Qs]C5* P )|BF eQTO(RƉOȘCmOȘK'wF&|BQ4}>MkXӗѸDu ?Dr%RHcgc̳ළ[o$9IvKv nB /iu>ܸTLFx ) P1oPFFx)#P=FU!exfZ2<| #S (Bdq'[(VJ8z`cq:ǴI' L:$n:?z H]D*^"(CMbE5ۂGr ۢ:;);PvTdװ+rIlD.ra#/;|%.?S4~"=ZhAT϶$ę|ʁ\o:>+@l3^[eL!H)Is;JAW`b,I@J .Cʛy*r-?iAjG'%]D.MMWM~tY/'ODcKU LMO<c0d8C5u5A07ox+^~oLæX1kcڿG /zV^o HJ-w%VCJ' , ֻwz= {x(<73IA~OI'NZ(|?qfק'? $0OЭi"϶/ [mcýkB`'7InkDeGx;fĊ+-߃Q1+!+oZ@T ;HKlJQTbU"\G~X;%ʛr@#wA^n5;*4b$iF1+o Hw=t{UhwN`3DƒN0 l%+q/vw.w e&]oCo.-_o#'C]orNyxQT橵 3Sn wgvg!WnDZ/y{~v2/# {e5Ct ZmaJ2^NJHslW-ܩܫr'fcѿK(gEP9h[Q2{|wU;v,+.Ɩ~4%ۓ7.gA,ۋĶ5t1X:ft7>#B7C"^Lѻ |uYqlBm5NJ*zUObl_Y: yugء”# \m}xAU ,FnO@Yz|}VKpWߌS& قnjS2H/ w'uJ {}}`TՀ_FJkm0ZZqY6cS#6}"떛U8Uߒ[XE5|ɥA2!]|Y4\F?FiSEYB{> ƣd5ѐeֲ߯[n|7Q":K4v0Qmi#k6OjdY2 H IM@7GVXILxVj="^DD;@ SF 7Gӳmon<y+Ty(C:]̱ު MOs4yl^-3%0]9kŏ /~*}CoLSwT%J+|7R`r;**LP -TVfdz┠ToPlʻ cNiNCPnt'[fT咢niEQ.TA{̟J59I\6nbah9y<`(4Ī rɍYcQP+InDY\)c?8œ~vP?{~KajT}#SyC*W*I@*-Bݣ4$KaR*Hu*F\Qb'%]q0՟ϢǔR*_ĠǺʤ-G5qÏu.i * ]-&,ŽPՇ tT_&Y^<0(55'xjخ[x|ZBӽCʽޜjOeLe6GF9@:r4Z_Vp:x}1(!62ۥRJZ/lrrX{kAq?6{um[e"_yDT?޻5<ȭ]~*`_)Qб6<úTܲ;ڠqyƫoq36ttl1/gpТ),,rpV4}!cE#TYnm}O ٺ*#_iűw`ٳTCq3ш>c<kyQ%\ĞBJ ϊ2b8ZAō_?,ݽ.#o-M :ާ~T0Q$iʦk, Y"E,~Y5cRlaB~dkPO!n`?a!_ZxY~y ȩmRӁ/~rT~tmMXfnYn7wzK %Gt1Rqal[Yi|;vYXxD7>0ees` +o;t'񝎡?eVB.`~2XR[.^?{}P?QZ]\kz̙Qյ75)F&GHt@29k= vYv WX$;8薘?Aw#¹ۮ$6Ok~3pQ} ғ9HMp`/Cu'϶/aVV@̕cvT"(1/y/TA|0Def/`Fm{,S9g&ЉFܗ~Z6*}k }LB.cwq;0Ѹ珂dۿ @&Ct~I)sAl/J6?M° d_߮BE Чm~2h#=d7˳4{<N͑'vi; {؆-T# CkuַTHA,V|JoM@zC#d\i*FۋzTvmN!ym® \vQmzYuk7NHtyjoQu!>݆7A ho}u͆roV~ߐ^jJN+8a^xgm,₭,V1mv4wKwl*Z&f'[8feAOҫڃ2Fxbw2}p=k/·upM`پw{\ţq|%,7}'jL~^b,gd$U{MTjmD/ʿف(z nY6Mlm_3uPGNw |:$hоq?spT* oB[5qJw!~>!ER {UDj/\!"7P z.QgOqrPJt//܍ #7 HѼp[P{P4ǒ`5!9Χ-H#EA2>)V!uOa SRE#2O\qNSiK<̎PFys}J;8 arM$qЙ!"i߾=CvoT)wi AY r,$߅% Gdgp;eʏ>Ht%j!?vBGwhl,ߛo oEmCoߘOHN:> Hz P "=R@H#pM 6<ڵ0bZ`\GBrJe=ܯEU3ͬ9;f UU(-Kor_߅ؙN՚:j o}li@B.8qkA*{z^uzq+لEorJ.v+/ jXb/ Px|Gw|Cl:Թ-&'`O`s,;Ww+ay;԰Dk[o{-Hk29E2փgr'MvlH}G`\JapCP"#Ŗ5Q_\K֠Ļ7P9 77upmX/lcC  c7dYȕZЩ~/e]bVGS؍쀰G$6z;ynȨC_Czc{DPjH!>6&bOgB-snMfl`y; .BOǷ>E}|ŧPP{U AȦljBN-PCS B.5䅐U ՐGK]PG0 b 쀰 &T \@ᛴi5\,ϡ P !{iB!.Uyy-XYZhGr1 XNqŘa|JFނQv{^qi@h"Y Rob0-jK "5?ſi>Z;7̊Cm pnZ|j7PW?ȿiZe {q#uT^o)[)e 1`oB8bڸv 8=VӠ}ftP@X"Y>e?xe:Fd=p_D$Ie1Ho>f u qƝ9JXͰj !QZAmV+\Hy``T==` $DB'?+#@F:Eu!*=dw4<: mK$SϣCz:EL9r F%=ZS<#'u]U%O;=-d|훾d6[R_1AYӋ|BD%}h1fSݸv܌VS7ҌeG:ϐ1HJ|hMqSF7}&//ĸadAt]5~G%L(?M y 2XUxOCd:#cBJpȥk'Hw{kaz849xqU$3!|%r.QHnP$DF-ԄuI yP#괐O AʵP%A/RCaQBjB-TBj a(:N |!C?>3l'4X<(7zY^uWz-QW[]Ң.uS:-PWشM]aբVկݠB\.)ע%y6^B ݢ H-)| UG/sZkx31i !oED欣 k/xTa_D(9E7g#L1(~s?Q V6M]V*ZiNgBc5fR9 D1R+6ފ:mެu?s63Ug$r\k.:'"6ർ6r=GER.Q-f1;2#+bVχlR?Q6Zf՚ّ%jY\u'O G֬ t2=CewQ6ZfӚmّjY\lDv:m-+h!TveseّYiEZ}p6ߑӦ͇y nZّ֚>̧5XΎY͇<Q Zs\Z? s>>鯨ˣ*i[Va$# lTl?!EU]1{ib ^և2!* e +|_ݱ&& Ai/b_[rw[b5ۧ߉Jn=D5xRu7w@.1#m|w<mN $t|u3[HU.V۬vw8jwRݶLqk8'&Sk>#Kz*{{$] FV  smnL;8eWv'/t?0K3=qœɳ0]f&VI~yA&N9Pv7W`ވxK7 6O$U4WE-1^O\Q(PWb |?f Eׂo}LfeDP.[]1x 2@#}Lؒ )V]5I#x;@tjJch.q5 oRYj {pa%/ZQvPyC]lq?> .4:!~fp mMOJ7nn3&H:uI M;mubbOz䴸˾  h;ǖR 1(=QOևhj%Sb1Iv)QKU_B:xo\+vx]iچqeDhV#xy!ϞyCt{[>}moMyx9{Pqu5L(l"1o+(eN;H87y)('?S!6F.$LRXl?Zb$Xч4nڳ 9b~ k*]C9ClRr[;q"cVo33A&>E&TRk&{>Wt\~ S4:ifcGjC?CGh2jJ KzqxLU֡wDlOS94B Ҍ9[mzx;>K.Y.nX'so4ۖs`}(4Nf+!K;ښ8-`].}T -6cֶG1Arc1WOg~wɒ% ^|Х4=UġO /uPmC;VW-Sa;Е" t z"93Lti6 0&]aitt܇g QCc+A@ry,=6=i4dx]6L$r=JߗC+pA_@gYaw;4-H,6 o17Wʥ6#B3p,`5HL_9+)L~8JX6FJɣ 00/=[=4_R=2mWLEYt2!&Ŧ* 7L`L 6D=0uLgO6Q Xor%XvPU4FV6?XE ےlaRC%I X p%V$mbsJ3/j;;V,~̪`̓m&Bwt3LžA~շcAH,~&Z8|qs8?gVIFg:.z JBڽ f7 9,EТ ]1?Xc:gz /p)ՒHⵟqK.mFc3]> ;ѺNٝB_O(,gsy+l|npOIF%IXUR_[Mvaz]cf: R6(G.kX$Lēp}-`]Ǐ]xy K+7}ca$nJZʓ9,7"*|YDQP|>@C9d2\Pdt RC8lKm õV+lŝ^+jdĥAxy* òţ`X&:r*[i`a "qqn VU6 vU}Fhw9DWQb@w(A}grXrZP qup~=4xPhH]l2>C@5w~TCo,nLF>.+k BY;5ԃ xIytE P\|?eYedQVC*"gųyu = ٽX}tCT+Eث\5g+`BkH Aˠ^t8P]MH$.UN[T\P6Ctk)C  L戰"T^\]nXn4 к4֥벖K+,HXi]uYIuXYeI;˙ƺDt zB$O6={I>S-8Y||KL h nL'fYUGI^Dܔ{R^p!_fjdC6+m܂sV/MKK!Jgi&?d /KI ̇| L o,IDYU %ճ'ox[H 篮 G[ imR3W; լjp/ gтQ"qj#fNC>\6N>*N(KkD]@f%2\;In MV$L&![0^ۧmMrwD yc=9#ÚLm chZ3>E] T̓) +"Fum $n"MaUᠲv.W=Afzeɑ?t80A_UTb?葝)b,8,JT׎tG.틯./8]rB?;r-yxNQyFLݤ5BJ 10Kt\"C#D)Di+nMDž8!RbqFw"-g%80t\ĈSP"(@ˉQsquFjvH)-gªt\GjʍD)>-Rܘ-d)Gh JڶT{u~qJ3V3$J: "!{s:Hg@)9ٳC-\),>lƑ2x_^ }WDLYjP @!o aЋ2{JƼxumF"DAAt?\rLX2lkfC/5Qr`l6ʤTDsNZp]4C%WN2dj墚LJyX->FW{ ^;J[m)WK7r9N6hݿK.y߱.H>Ǟԣ;x6}ӻeyjA">s /dpZh5y%~'+uɶ2r#v!eq>({CHa46Ivv,]trL&`C-|l*s(P]{09i2o,&= ;G;Q(yAC)K%%&wv {?ӹBW/eg ͬiԇXC,16=;űM)fVA}No:ϧ19[ZY& ](U DSr1N%thܓ%;8KYU}'Be#QVemw8!BSBYw4k !ɪ&g] 2U@&0isҌ4xᴅW\,ngž(?H #zgɛiHK/Ʋ"(M%4%1qƶIu|l-;kraNGRޓg4Is9-ҜŒ.N/lg<bAv հEbhYϧB h,7M>'<֖׿E ax飭3xڶah2J^ڞ¢/SřSj[8ZCokH5cJ< 05쟷~<>@r+\ǖY~=VV HsZTyaH|bi9 %"a&pp!u(Z͒V8n;$E l9-Е/{3zŔ^ӿsu_տ ??ݝymA>WBWe@^k`ˬgGF w$ *2w㋒g}heQAF(}isrMtaZ4Jދ7o}31r34>KS8$1gt]*9n&΍v lt޹(ĉ>CK\TgwϲKAUŒU"56: , ";hԘĂbECbbKkfYYsM}/̙s9{q=!ZfhU~bg]Ɂl/[כrŗW 3Nݏif/]q:Ȑv{u@g q٫t.t5/4ؒoU^ =V&h̳4e7e83!O*ϪC2|"I3p+'K$x[5wNn$+&uEʹ;[a ߏh"g$G4cn/,SaHgݱ=ϗOVkc^V¯\YZDrL81s #$zgBS}D>bd+N;"I;̳;quDƣbkX9|e! ӟvM`X iodzϸy]Ȼ!B>| d9dy6-m^ZPeC/a3t-hV(N\пc0`ZUx3=e_9GZ9t k8%͏Lo_;4NVrjnm)š_p k^toxQ[YEl:WZS?>|ϕS$xTH  O0 L:  8 #O3A9O@ڃnh<` 'I5pnOH?5HD !W 8vW@z@6t`0 0ă X">4&A.B #  02 `n]t@RA.X @1pAځhj V',8R0j.*0&VFwy0 @o- >P VW ChgȖt+u:yXsf`BVr~JYdp"4b?O. ~` +)0B?W'(AK[9:]B6J`#[H9xW)pFa+(A>A4~1xq ?| A<+> h#G8x^> cEX !7A9`}|Y;7;~i^jzvXgSlXrd0Fk-;[d.zSO\ASqJ8]d"?$Ore 32S؂ZBKi *딌II"cH G3,(Ʌ ggO^Ł`_Vw^okp1fq~TFPM@O擝;ރB 9(ޮgUmjE`x-|8 _8q"GtO7UЌ*m}'y̲j2BiLQ9Al\O2Q,TTeWT{JZMVt|jZ7 miL z҃ !PFt 3K7˶lwvϔJo2I9]i=JU*sJU٩>QP9jjTTUΪ`UjjjjjjjjjjjjPU]LZFEiq״xjk5~ޚ/44555CXkkkhkkjhmv6\ԎԎFiK˴_5# LVUd5F?1d\\\\\\\\ܠܨܤܬܢܪVǪu eqIltQVUJiPgF-yo  <~hb谈#FƍM3:7m1dr+WE^]Ž0(,|xq3g?.[rJoy6ihboށg=rØIpzaZCct(l(8ѡ/%Kޑ7sk$}ktW}G%.:zOnh౉&4fYfU_>0=XSXnܐZOW̋,R z>ĪՈ2+xaF6.m6*mldߦښG'JK.EOާ.,ﵲQ ;jxy8<ݯk5NZL#L\ggUu?Za_r$-OnsSǖαQ7ڴ\5]ܾ[Zrpb,qσ~\ym_{|nwVٹ;Du[wm/hgծwt7="6{v4J;t++ݮj`W!{p;}tMCE|s>:}w*&wNמ |q }vb{M5[/y7u(~G4?PǷ~ƖS{Xw^<ޅ^.>ѻz:},{gо?WԷb/YbNMoބ~C]wkwi;Eeg{/ /}o Y-0kyоv\cĦ!&̼rݯUhB<1qFݱaf> gvaO8_9%OCW{x=#VLrO׎htDӞE>ޯ#G&zdL4rQ#¨ID *9j(빮l&DDɍdV~'FSbz*;7'cm1Ut۔؍-!RS.NP/ݡ⁺Fq u}0.Ǹ-&cܷzIpscڹk7vX_n{ꍱV7F4a];%JwFBw= F5$ خݸoZ;}[ WqLoxe7H_3nn7pw|ブִLo1m'5ڝOL~:M2ׄMGM:a'x?( MвE$u^.i/fE&,OM MzsS*I'up;i*i^i2|fp'm$uKN^n~'/7?GOW_gow?Xa?֏?Ye;6x`ろ6Nxaㆍ6xb㊍/6xc㎍?6xd㒍O6Nxe㖍_6xf㚍o6xg㞍6|`6O|a6|bJ70|c?6|dO6O|e_6|fo6|gf=`vf'`vfG=avfgavf=bv'fbvKkkNH!Vi%%NNN@,H&:y$|uC)l;=~B}ρ}7}S]!4"}."(; r`w#dEV~ZWbJ9J42JƛQLAꔔԦ{#JjA;%CɥJp,锔-$?\2k6ɨ 䓎 2w\ sdFiuTAK$Xe-+nE2YvH"+2oqbE"5iWϚ&ˆ[F3I :5m`CNw!82{ qy`CvV%+M-)oK%ےDjاɊF|~]h-PTJ{UEܖ."ڂe/dWi-\-{Q^_c[VJ"*!}zӉgߜdw @Gþ% Π ؗM+]ГAЗ=A^0\}ov/_{FޢՔ\`Ui;w|KRD7/1V_.ذ'"'ONJhː2c(#2/Oov"\*qN"#ȉ\dl)31[$朅Xji*2̌%Rc&6!F,LΙI-EF&\b*srsq0>ՉQiI茉 /`BH8X4Q(&ۛ1XR) D+Şq8O\ .R) H$cg:&fTaemc[ͮ'5j֪]HI"bs' h1Ug XHbID'ΚDd'C; 1Ek͉ᴡTyD<GwjU| 4t >]컘#7(D":$;nȀ@ A"{i#xȀ{yLu2ŸE" !دc`>Xւk6wWΟ kж3Zh/ (0V0Z| 48 <*ʾ٪8ll{Z3W>no!G5Lcط٠̘!  L&o!Q +-7p iȟY y ٦0 _6 k3=8^f8^ @@1pl}m:sJVhh `ۆ{"4VvCCXꆆX}_^]]u~4x# §+߸o,0Fc}Bc;?Xw. o#\U2 &;ޛxC!>,69[:ݾMJMk;p}x|(D o~+H6A iePeI'|{u?Z*A%ʺ3;x:8ytH;X>yu1PgROWR=? S~A)xOoәAAAM9Re]ϛ~A'$t{I8?$F^ĄR %(u`K#ɘ؈ D'$Q:0fX)"CBC(QHLTI‘lt\`d:EƄIlTܨ0uRGFŢv`:szõyM{{l=_՚ސJS $>O6QRY{(쟾0bR )}Z׆/WwO\Uv^aAz}}l^֏՛umvJϻUzݙk!A|9:G{`_~!' lϟU1 %š"nNp-7Xk]JL l~Z1ьl F?xqYE'IA ՗|fĥij#VݱO_*GVlhYEZ9^x`tJѕkڟrmM)dϊHJqmNRNBgAb/[,% Bt}tB8"WPB8ʊ~1, hH{Fc25 ?  {c9Ch #aqel-­\ k_%k!/.x7J= `|"k6lzd$b1 2l@۰86Esえ3ā 395 fa {2 qRjwOi~9|߻Kus&g>?p)xjE?3ÐOhcgyB25y? V>oɘ ?O*Mʄ,Nfº l<RY_V 8R]X&) /h!(ͥU"MF|4_J~p4 ҡ ,?YFiCA*R K\P)W:P Hw` Ji0)gctvafj@pHiRDJ0P#,JJ;FKiRHX) ک4Ca # &Iu:כ; y'+.n?w#ѻߺs 'CpN/t}D}n>w w^b w7pÝ[v1&AXї9oR̅[o3x+ౕv ` t$[<-_!^pt˿o3"2~K6s,'-% #fXGs˻6& A-5q-UkW~mf!~6W尳̿f ޖZ9s#oKm}cc>*S5Ktio%q>I`z1G?a'AsXBf|~4{k|+֑.qt  k=/S s}/*_v H+@g @*\ ZH% ^h%k(]79vٔB']ѷ:]7m UNq wn.w*pƗ}q*vN3o\͹qCo,_|/7d+RG_g!ݔ-qyq]Ay\uRzQ|.8/KmgG.Ԣ.)="-?^/e}T- ,?Q~ݥs {Jzʇ"{oK\D9 !( Ed7҄oeXw{tD-j{j {9N\W{ݵ&>9#gՅ=p%MgLr; }qg3&{x4&짳@[v c׵TA*گWfP7Po6+=33B e5UCh_c[A=0x;GA ݨ%6B[50xcwA.|WO"R(CxlD"hAZD"փgO蟙]˅L(\+ S}<,8}gG̅P^=a8 }Axn2IJًA)Ӆ*!\% #{/YZf?LDDLDP:{``ET F#}?J_}?_܏sגik)ѱZj.Ul |XF# WA}o>Z}(v׃#xGGg ;A =v~+z*쵽6! O˄\3;ȣ:g[IN!o_ďOvZCnR?+p`["Պ,lڑ~e:Y4H׍}85TP'_oQxZ5wkUˍO)!ʭkW򇌉{ yBc"Bb ÷WlrJ߆Vɟ__̑'0|Gidt681RFghLlྏcMGa=-/`ȵ i]e\- Q2so`Ѿe}kTtxf\&=A#gh,2 "_^OvL. Wo0uuʏ"``*(&Ce83TXv Q8w!ŠVP0VFdJE_v_mXg2J7BwK"S6]zw5# zI~W_I 22# h$@Yy=_y>#JՆvo3rDO n;_z S;l{F]yzA'`"֙tvdH| 췢_]ɿ?kcO+|H䃀SWL:ί\R)JJV _PɿߓfH?#4w%PQ[V((%f#&nq_1*Tp+QbPn"FfFŸ?F%q%0b99}Kjz+{N6fa=c&7Ϋ%៍>|d :bD؎UC umuZo h PPMP@CN~p&j+/4^.^ʀo(pm@-;}o_l1TfU9pw[Ox:fGV$%i~g=iY:Uk~@ܦ񗝲Jppd|hn5id$4Qf2:QQc%Gt7h-|c@~Se+#U:y2z@F(db(-AFI+e(kd6HQF,2] [F9{dq 3dt$#"TF7ɨYKY^_e4䊌ߐѳboQ<-< vS6XcQlQ6JuFYpWBf!$4Rdm(uޢGڧz1 G^_ы ֿ~Y8'#sg:ʾя$N:0Ѽ5_Sfh5WbH{4Beu;^,yRt߳I<)#aPby6t@E%Kz_u'3~+DZ*CHdж$ڊTvmF^mHE-eyb'Ca+-}^Đ8Wmwa[%w5&Fܳ*{lxLWU=R\gx7{|LϰkI1x+= s*{SǕ+ުKgyOb3Xu=G%?Y> e?p׻;q[ C V IyԷr2t!^7 ;s3H>&5p2l=Bh=P8}LX[]-tM!xX: ML^-73#yp/- 7Y UruJ]e6H|2hɴftitNЙ4mv,EKiʝ4g.;b7 _b 8XZx`V7^C^O^[^g#^s'^+^/^3^7^;^?^C^G^K^O=TdcĖ /'c>f |@Xxq1c Ğ=?>&!||B.X|q 9c3䆏m#>!O|C\7>_@)G>@.\AW>AnYg>A\qw>A liӎM8\zdwiӈeMB!rᑚN8L}56wT%qg#qW[8x8ɷ3(R4$NMo-%/ۧ&7SE[V 1">8"<+yJ xA4],'w)f+Hx"x3ԍ}ANB.V%'yVQ>gj#GUuC=rYF&OwUKnkrEӆd $98l&PY!/d1B ˆqN_x /2?%* э.=H_OR/r#٩?j ` ! H&{( #w|EVA IEVM/G&=O<*M L$ԘD.W!UJb+i ^<9$yO')ǦդD15Ē\KvgP#>IZl26k6W@v5s Ys@{RoCDv_ZIQU9S;oN;IPmӍ.}ڧG)nj #1/t]u|] 9Z9bxy Jkw}urk{G}eo'O8;l޹wT~2/TM3#HHRPdه;f냐u}6pm+Σ"S߽(w}yF +x#P*nN_mT_+~i#G]v.om73FMD[=zޟbMYX{v'c ow2zv'c^.1k/Rr<,?-]Oq=.!} 'Cn^R?AyfTh--B6X?j\<]UX@aq#}19T@+˩ B8` ` 63m|h[VK&i'mC6^R1¨0F1Z /ET֜#+ʩ96cLt,L64Lf_&HZbkeK͟I'k; bwM- 6!i.1+"߶d'؇cp d@:l-3deo@ CY`0NpJse_ bZQ@e):#ew$h@B9wЦp d@:l-3dV 6C(E 4LO 6N!0ʫ*zF&a9>6c б0]fl&|/Gmm_vBZ7CWP;lP)vYEDa8>6cL&O X.`l3>2ߌ.u uAQj_P"5Ejd*J'k>[%jhv&%`B1Y-L[fibeo_GVL#mFD^jmPFBSAl葈efh hr߃B1YtL[fibeo@P0ykTB,TT hu"JuD/AW)E}))c2\13]flf_&rf@BV_*͍d\; ӡv /m9CmU :YDCix m ǘLE3e6lrz.,!wll?54De&6S<: he_Wn/bl(b()c2Y d2]fl&|/5Gd'2ؙD=v'!IƗԀ`w"YєL#AiK ٝ+7[i] i\[ݔ"HDlodIECtĠ\Y-NHsC;ÙgzLa6]fo'H1ӏOPcQ>msshVL[xN#gݡ3{a:zVWb%dn|E9oy__5q[ef_zs!)C<.W[wwu0ZEZޑb_Wvxau]Ǒ g{c__+ {_ݳ81XzIKw䏽I0baLTߗk8^ćp+zޏǀcoYqy& e:p^dgbmsCړHi& 8f eդT%R/ez̉k$h  }8e q>x?vp<pc >_pv_Z8Aϊ/...|~:u|~E< 0ޏ=n |p-Zi ޏ]B>B`y\`9p{yWF >_ pXՀ{$PC<pcx!|~2 ? N <p~ EڧmOhy-&,񮓕vnsr.=8s7Ktc:uEtߪ)gu`S7JL\n-ܡ;.]WkIWvt>M.n]3]RMw)EH"?pYu)jsMwiT&Sݵ!D5R`-4gʖ=$8ұHҐ룥Ҷa%wK͓Qmd:H[*$m.I>k&%g㛤Ѝ[E~l._Z$ 9iZL騔=Wrۖ'l?%uVZt\ A<_Ho.JK}jIg?+q_HXK~|. KKKk#zzȃ^C3>T}U'孇}kJGںzn=}R,ןTo'TAvb>k ۵)NvTW?ΌUث,9jwj ޽|l@;576! '<CKw|φH ,TD\v\iH30ٝ$ ;˖/bl\DPDE/\D TbAl ;*vTyNvz/y攙9{9Ϝ3s{HFi`8SpDA8d9ym[/$XϱȘפ]RP.v;3=O* Kz2=pN98.9\k`ZcvN=< mtKrR1rc$4'Jq]]߫1^xyUzP7~ퟩ szwX3ߨgp[bY O}iI<dQ_8g+-mlt||Q1=G%xGgz-Z?Fwlfo,Wu\lfĘn_G:f꟟&| R]bGftJA?=ŲG<;S ᜥcdJ·uP)OB|DZLɣ̍Cټ 4߽6S!sd>`ϐ{}LgvgJa^cf1bfQ߮y5 ) 0x(^OL~ep"x%S7 "O?%S,9!)#Sr=cΌ߲)B3`X F:%} d82))ޔ7nSd'UO+@3ݳS03qgg=XNsJc~pSBpyȑ)yYČg7z`Sr3-wKc#!?)q NI=CYL߼vJ 2g12J_ C+G[b܇2+=z,c&2:eh[hܲKaHj0\"㑌K s]rǹ+/`:!{gHKf2UJoCRW`OP:j&h1뀤U?:_O? ҹߛ&=h.Y7$ǰ2YW)poLW]7f+t_2|5Sy|sxܜq.@:ψ o', >&X ܟ)QQJorJ~`u&S2/:%1o +AS3(=d)f1 )OrJa2/0Jìe>bg^gJw\<Ϝ̣̍LrJfg11p9Nk#}2;v:ldyF\2) 016p#SlwH=Y)N6F<ݝ8<f4Xd0!! J+.R(fݠ' .S`X04ϔ(AQ<=C3%1fFOYk-h^JFޱRo8)QvE "Cخ@6MAȆ@e7Xɜ$9%N\ dkH=`8ȆT42>`/õVdN](;F!?/(&َ`H<3$vJ100nR2R8ΑGfm({=#}BHHB=oRC kWm86!Ot{Vy+K{=K"}B Z2m\N=iJC_!] ~O_4 ~N$;r>".?I f*=S|X&f10$gG[䢲/uJv1_2[$_8%033/1o331g$;%o1ȩ}̛:$~ʞq s{lG:oq˽,=+ePt5%\w.X BN[|p?t$.qwH G>߲p#x {4ւ,y`#a?P27s`C:Gb?b%9 =x×;Գ% `[ɮd{+9.6_v;+9U }J 2N.vUyxe'K3^G$>&e/H' S{[e(W$?H^'p!z@]d4]4Wr^=PvH=WP2_-PvP6Z;} o,I6گ!#"~?%~D>`< e4? 4_7*ܞp? (S;@p;Mb4 `8'= 0`8͂ 4:\LopgÍWOXC/¿[pw}l[p?pwz_ fp^p!-茗!#epkx;Gm5o¿ π""PYpρ[ 874p{}  ?n&4bФTtc;^_KX+By'D6Huݬc-])6O4P^6Z)[!ErS.ds1-e/7~U%_eIǟnomtOXs%I/M I =)܁_W/=xRV۸_:mkAzO9384S`*~S ~fRQIcG'L ܧWզ-."75mY.鱋p-ΩI#M6i{:ӷu3?zN{IY;yqci/'GE`M"nYOG7r^V[fOkqkw ~c%(Y.RkG"nCޅx D % Vϣ,np$HCWs`-XY  }@W ^`1 ?pH?vM۠78Ӑ0 6lu3"=kwA &!h< ;{/:q:,͓f}S-a4PAFc,s@khk{pdxX=V -B!_>q!^7j(iUZ^%"=U=QuViXT(7`DuJB"8]阄SGtn0ӝd?SᲃYf|ؒxQq[<%⸊A{!ϗEw7˜s XMoN^]XR\l~eHǁ\ܱ߫*too6 C\tzM|ߔ3z^kDZȫDq=m9kR؀QϦ8+Q3[40TkɅr0[;4S XG"F @O+jOϭ"bH@4 !M?:}E=h9[;uzњ&V#[z_Z3$[<k5"T'e6?6B:ot bf;j9>Tdh("xL;}< ~ 쟐RG_ fsXN8y(\/Dviz_Zc?9^3Do∛ͰO=@bBf@ע2:xJU('Z׿f3:20!~K#Rf:nZ/lTX{n 2Z+E~?B)_W$X8Qb.O1Gh>3s /]dyq5BL///RJS%F+W<#@VTjoQ;F#̓ E ǣ$ c>7Gd P>sn7(U46r:fNf{pL{hyQkB jqbB>*FiuhaW V 'ڙy43rP*Um([#u:gWT遰lH'cʗG#:LhA^VGSRCG[Ni|#*ѩه_4W0xiT^6 ܥס<_֢+_3Z /G(fĕEQ(ZNF|!{At$K'ͥ#%2iRG;D-X&JUkxc YDsѰ,'R* P!, ,Sdv "F̠JCi3|ն(”ʈQfa3B2JCwo ynv±xsQJUZrBlImzyke9C z34PІs?Dbو8U]{g#14$ڽ[Tpm{4#_-Gd֡TY*˃(C*Gm2 )z1C}&*m:q +a%HCx2 w.ez2qD-GK<,N7QV> SCJ S㣋Mc9ŘSu䘿P]ſqG9i8PC|''F2׀~f91tUxT2Y#s{*UyVWN1۪b#A"̢EZXF3ĸ?4 _Gx$4B>MmF LqJ߁ҹ#g$KR"*xS݈[ 6]&RD;h}my@9+jp#5Ofi@p;wmwIeE9"i4ĐOEŐFīsph}/+uM^[iQ'!~ꖙI.pH瑩.Z7՞ꢵ\ؾE{"[i_)j遇|Hdb*oR:q@=GV DyXĴ8#)tJh2].L9ba#,q=W5kie$Z,o2,"ϏHpbsffshp}\6~iFG^#uՋz_WѠa:khy( h1Z`PPkZ7DܱzkmԺ?꡸FY^3xuz+1t,*b#T׫u_e} I;\1>3M|c+{x{ cFuC z$Pj5u"72\±hKQ~Aژ5͵T?8;,j"" 4P M/"FdE&7ODŏ@5Tg}kGZIc?9!h̠~9#;2A4d4sZsD(Ug qB:wQzTi$t\T:jfzJr=mA>ϒ+Xj:B{8 Y摂=`(ܨ7C\$;sD5B!x1lY9t,AN3L3w 066f5oFдCw>)N*nރ@Ѽ3u-Lwx"\?kFYo]~₼9]w߮/|rOۦN{4|}A3& zy[J>M?yTNy-\S9f?qo_?~s#^6}˳+?wlvvޓϬ=k6ckgѬAon7NZ[w7uxI}_l`ʕ?#C1qc^f}um}C!S\w <̘4Fdm+;`cRڰ%xtP׆Bgfojv|Ə-`,dXv׺Yi߈_aU㝳_,saK흗/:&t_hikΪ늶|lZySf>}+ ܫ۟p밖j_{vǯc߳ww ݸ؍}M*=a3,PyUjo8vssۍXSjήMj |4öMmQQumaHi)AJ.AJ$kAJJR)DR}|׻?>ku~}`58)U_l)᫾]_PIR˼n}DI a% ںs֞b:\Ckg/.dm5lu'Q~=yy:Zd Ourq% y-;`><+dʂIȇ 9D2|nUxԦnr< -+,G9ڞ8<|xUYX^]\v4 hլ9pD,~[W~%84-1͹>;xyl`2d$ ƿ"\MCǢ\N<9r7mKr"> !S0zY>]EY•Ni-ܟͩwaOzRHLߏJu&rEEP%IJder[c>#(Rein,-z;1' ,`nWoq;&;cQ[ҋ2Dy^'/g7±Ґ[Xz6[e`}R?)}АN(#[E7 >$ޭl.Q$q, ]'#$-ТCHSV~m9[VI[!C7ЫݧxYRHM@s̭i=msHOLH"l6dݝgu}GI~=qBw & PvE~ gӖ #I{x) r;ۉs)@2sipKoʼҩ#z1ޤWbuDʄ 6VտHy #v9e LE5s[DR'ԟMd~B=}~0|? )6>PZ:>:zʊaO (ܐщ~J٭|iH`2.8;HE&Tw,(t: iJ~K@<[X \1Oz')gnkRB_{3Ž&e ;MW]aNAq)lE.t\ª`!"#ZYdZf=ʏwD#E*ލ\#jƐ%,WFW>v^-><‹]ZM2$+Gaz4lvEGs6$E_L3j1&Hus?˾_ez#;u!u؊C{͏ͯGZ%׺0eZӔ* [%SKNMH-<C*iϴ$lQCS== !}Q{pR^WV.y)5j\l}"Ǫ9?<+2LV̟; +eh]GC&"C(WnwcbES,ޢP oYFϕF;橀 ]9w@Mkf_B91Oeޝo'#ߝSJH%H%#6Pe#Frhrۙw}(9NӍH/^$SB%'QLx8pn#z8Td[)!W!Arj UtOg PR|6•=aӳ#?MP3 mL_hNaW*E5uA_ p3OʨϷ wv;6Il8.v:AN8,z%9 OF㑠eܪrKv~*w"u$ąCLˢg5a}Ϡh}~u! ]/dc0lZ4~ҋW;qD.| Hm147A+4{%_)pq 6SR6?X9aݯ=%^K{[({"Twok_]lFiEe NdiRRFMY%qdHa;.ɘSwᶢo(1U yiZn6nQe~*ct-,Є\| ׍=@x)ݷ\|W _5y "Lp-Y R+ Zϝ>7'#`ːZ?>'sv) 4|m3m&93;(9^etV^2(D;'yuzE)NVTnR3%]ԺsHb_K9 u|"(5WC4C8]tm&w=]'j։8k_"F7Ք(='U$ͳj~xkpHJ۹2YD(z[7Bf E3>23Gs:diqb`Յ>Z[TpFkigEIzT+Iޖ3Rn["_ee8}w\n'CįƧZ;qUZ?_+e "=֧Lf9'p(m2P 7$(5Xv @Ej-(ɒi`0] 6\;.DK6Ú& җ>\uq='t&Mn-)| 6dR%&tBE\^P5s'&xolנl׶o( yfy>ke4?jـTS}~ipu^Uyڡ`I'߆g7n?\dzĜ]{i,ѣc-jIt|js6k5I rE%//K"S{o sD迹 jo lMdjFh`5Շ?^[Q4>HJPDPLLP721_Fkn:ɉs907v7@ _oϿ,߼;# Y';#ߠyX7[/;OMk7uPS95nWo(8x^N0*Pw{C 'DjFiZZCKTM(=CjCbDs9'%HF AEE@T@T z*vUꪽk*S vT[ xxRn:ҖO5GP l[5=SvNAIQ9nnA'_0W-^j5XF2tqͣ ؈`;:ׇ>!'a]9((TTPL'׀A@h T%KbqlIՅ 'A#`CQ}ڿշ&26֟jL}]"w(f>{hI/i b@> vHIIdkvIԭ:}X#%5$i*-LͧKs)m8jrhJP(QSdMmɮ]dPhx{Pc6Ƞ+_~h_qM?!$?>jQ z8lU.d!C-jtH"B"$käWXOP$@`7 ou?Tv*2<}| $I͜WITwq @rJ& B<rT8P"'&QwuY6QܨӯpGfg3 Tgvե)-bqL.5y0ĝJS570=.`oOSF9"7L'B 5q!J/Pd0!>hȜ >( pE jCLp$<1p F/j^K`04IRbkLm)sJ/1 jF( ҅$_JJz=.MrFUkl4 lH֐x``@B=[B%$d"! HALACS&:PLO5ѝ:axRz=_ϧl#`Ou:%78QO)>{ԃ0 GSCG p\W p<O w  B0 "(&I5x L 9`,'3,+W |~?_x҂ # 'nyM򃂠(nAIPNp7AUPA]P4ASA[tAWA_ P0c`,S40  b"x,*f C| OpG( _oi?2 @p8z#NJcqpqM-8"N'mʼn$q8Yg3Ù,q83BqqD\ 8. /W+7|-_o7o|+ ߎw#c| ?ſO_s"~/B 9HvB .h7 CH RT UH RB&iC:.C!dC&)dC%dYC6-dC3 C7 CP0 CP4tPtʆrSPTCE2t*ʠr@uMj;P;uC=P?z Aϡ( ^Coi>Bgh9+N x/O B(!N Dф!aB,!OH $Gaff9a.x# oD`x+,KҰ,,ow»=>XVU`5 kú>læ9l [ö=;î; {þ?áp8 GÇX8NGT8|΀Op.\U.J\7F nm]Gp/?Cs< '[x~"^`qD<"4DZ"A$n rID~QH& "D,qQ(ONAI<@T"*UD5!јhJ4':NDg ѕFt'A`b1F 'F#Qhb 1OL &GģLIb1C%O ċK+ī* b xG''oA!aQ1OOgAy_8No)p?"~W/pGc1Xpl87LJیq82N'Ip2mx0L`& 性< x<^K X  |*$> i|! ,<_]___ŗKe4|:>G/cq$ ~ ?#A v6@\7x!>h"A$!!HD$I@$  <A zb fb 'r< / ( "((: AiP: eA9P@"t @נPTUCP=݂nC-PtB}h%4Ch f<},aA ONAIP "&!%#'(*AN8H h.AO0 )8i`:fY`6s<0a,aaX%`)X;`x7aUXր`X6` `v` `8 0'Ip2t8΂sZE|. kz߆[V~ OxG<Oo)x? ^W0@d$2,DV"GDLB%n%ʼnDIQ@EMCKGOT$j5ZDmQhI&DOћC%Mn}C+qJNL!ӈ' b>xXHPw COnnwOv(; >SX~[&ji/},j #([*(YS*q46#—j߅yqj?7\HjDH`$AȌTՌMLULv/Ae:4) qM2RSR46Q2QW5Q3Q#<\ICPLISGIYGJ u!9arm>//TCD 6Jf9Qhr-Z }eF~= =Go l-bs:f ^[ RfކZF!_C/!Ljr/zf?±C.M-j*FFjz&HkZ٣]^@͈b_QX\G_EI^WIECSOkjOGXH_߄BUU*4)ttqS Q/ 1E@L+9m ʸѱ70WQ36WU3Anj-ʧQ +>zV?ip C5[waO4֯J&A~~c jXV찍1{meW) .F㨌ZIYEUMҡzF&fVN.n^>~A!aQp.X1?s~6g˩N2PtsR~r6/mb;ލ9j"oE/{^*E;HDgP~]/(I?dJOQ:،sd޺"i ) i$/_ :!8CrDSTǮO+H#6X0V^z(VF )ቬ)!H VAOGApnŕr ʙ+uJ`K A'GJEbգλz¨2ꛂp]Gpټ(\d.\ ;88 wp{\?d\?xܱ??]op'~kl B l3BwjTS&G/OA+)-'9:R=}( ATA.T=4_Ŧ6(C8Fw2v)cݕjBZES (B`Jۮ.ʑ[h,n+YOS$Nѡ;UD/+4\,uM-Aއ@Tʿ %(GX¢{]?Qe]\2oϔHIj O#U@Y#z>QKG '1kTTY^W3BUX&GBu4a$Һ.wC 4.MRD;oD:.#eC~k$ I&BHfz^h_9rAѳO֝$7*?tCN* v C4:Au.utmU1qex1?Q+Զ\LIEB^е[+J$$  H@<D 2RBnp&|e̥= ?/]1B=g!\I 6ZFQPPN> kC'\1OI"b<`N՝c+Uh&ޮLQFT0u#M|(8@3~S)3ăO2H2里gWʪDUնbfX_vm[\AZn]O]dd(:i @{c~BjH^w?GvqDu= )IsU3]Q&H ; .([NjgRpUՏGhlgAѧ uC>_H 6'!"jDUuL%#&ORSd?%#/crz"71}l|`>Zl"u 1pE>)ש<\ (3ס __Pu,*ҿ>RPBA++'!גU ScyƉfN軶.=atI-(Q DBQ|)zLᾧ';VrP;WG <'Xvu<~BEY"P>tSnP?g{\;H_rAG__t}]Vv=Ha`;ꉞBq+Q)G9$R>΃\(~"%ZR !ʑzTO${0_W__,؅쏒6 Dan(נp@WTDCݏ2%Md~#P.^0rc^f yQWȺu@+ʅ(BۀBIAH)d Dѳ&QH+ΟIqoA8|r ≐O? 6=%m k.t6_]h 3#O0Hoyπ;`ደ48 X},<>[ZۃA ߇~#xv, Ka0~kM0}tű c| 1| ^~U1 `p3G-'~{?| J`,̈́4 `Xx,_Ğ_6~X0%,`1}Z, |>{~,? 1X0|-^0ᗰ Xѽlܢ/apV{~V, :^T|;  Xa /߄aP ,LǠ7OmbPw ?A cP O6-1ȋ~܅6=1WcMŠ&7 [P n?mbP_0o[0! #_ Jb[XzN`Pï60~T_OĠ m[cpmGcpm{cPc;Am 7܉wǠw1oD AE ?Ǡ4oA} ?m'o/??C???/???w/_?o?o?x'P5FjXidMG߯F :m40"P M4@hځZϻ>}i;ՇSۗ]o_>zL־[@0ł][8S7jQohݔ |8a>ЃQ&,*I?SN~.ޮfIa-PBEZ9:hJXiO -p8".YK`R ]拞!&F!{S $)Bwc)֤PCK )y !Ue`"$ ! IHAB1ԅAٔ q_Ž)]>C)ѽOTCB #ySu(8 kեR ݭ:JpuG;5HȰQҞRoŀ Pή ,>tP?4&Ȣ7[ ]u- \hdˬbJ@f>䴧'#hr /Rwmp a'g?~[}~-ۧc@pܴk˵krh~mY2\q\ʱ;Fejd^Q Y^cs7wզ7WVeǫҲqYKބO!_?v|j/[U{jze`鷣fyEI?spx2f`g*sWDgWrlN_XE\FsUDݑOso]fGꝟ_b2:+8U2@0Sz 1TtAHOu||&y 'OKmu/f뱄mNK$˼kY)Y7V S+mN~Q.ioc9K+oJl"~+^UeШ/[ /Ccq&-xQ;gpω˚7 H)K]Wa IQML~d~Χ[,y}SMx iE-w2N \[xB=2: {L(±L/|ɨ;E'}òO xJ: ]2-k=;i-I]q{s99'[zt[ۭ,2*{Jl&˦ۧ;n~&2gNeM4U ʏ9i&d=7$ξ|-GQȽ:]'SNIͤoQd cQiҊCn^El4M]9igD7-{yLdd^ܯBqA]jY {'%~'=vDBv",v{\mucNp@Q'WlZF@>!̲7#zS>#{08C繬>yKxHPVm*q]"l:r}-.T.cwk?dhj)R]E_\:kq'仌YlHjT ODrm.:mKVyyq<'_20Dlx;KaN~2W6?^*Wxc*q2ה"#迱_m?fVK k;@$3H(TD5Sf`[@,7xgvO<9ֵbF ew|tЛOCBۜ~_O._%N &*6~ٳ?Yi=:Sh,tLe7Dq҅o/c(஍PN#{ 遱DWDeB%f{9}xK^:"2')Kaٮg+AȐfD&AӮn4,*ݠFor_!t$~KiU6K)sKU]°=mwc>3ėiDJxpԯ~&zٮT1pht%%͸2]2 /K~: :Yȳ;)oWy5?]^ jfUlLhވĽ+vP78uOM<ƁPѫ=GT'X8靽o6[f<Fך2O*Ņ71YYXKln*IfLXeHXnzC'cіE _-ƫ'ZFs[pe%+{$2l[%_b\թ 96N>`hD>Q 4$f8WUA2eLOt89` 7$bjYQĔ<T90 l1~[9OxVgLɇ5~(ĩ)xFf*Ho\tYM_I++w#BBv;U-Zq=\v;WWiT >bpTۉSUf,=X_ZHM}.+>." ?}֕|<%=n~=kd ={xN;E>mY(cwēˣ2e^sf a -!Pk<7M;OܦeL")/ύhgxa)hu6VC`Mf?5:2 ЩvVUxk*F9Gݍwo=4h)bJilY_M>yϸ !L~q #i.(k:?baehibXIܵ[a+޿+jΟxK[P: "mRSaG6-~ \WҼƓMXE>ئ,cid{u}<\۶Ox gNpmn1QW@\x_ ~g-_-q;?$ 'nȦ<֞S1qt:f&95J4Mĉ$X>Ɏ)o'6;.}Rg$n)hN%Y_1&p.1DžnPؤfG}эC<xv}to.͡_Ww$~k>i9; 35~b=fkܮW7PshQ=qM }=m5sY-M{+>z%Mh|gխϲ2=fGܙs(S5j46yuzyn/ ^>(׵½9U[:!~z,Ĉ#~ x츝5rV!yM=hyru)zӞ7;/6 n}=~Pc=_zx*z_?T|reWV>|%YPٕѧVGc͖7)ںkx/VV]5\Ku*^4LF3g 1O9[`u4߹ nyqSUoZʦV?"}L4s<2.cf轥[gXj=7}X"cR7`e@EB?a]7T񸷸iIf>葖l߮>T?a-혥ۖG]R^Wo :xV }X6/i6u/=9v09ypf$ 3*h.:MK8ϖ?/C.WdH+%8t &aQhnkZ([g{F*z}&'təNxuvRN"NY.} ȡx3elϾ^6 }+>Soh''ӼqƋC'V{5~z7oͳ!霗|gM_=Wv~Sg4w? ~;Vkn˔Eᾷ"2䠛 xxb}yKϺw;VJ{RbS*^h𕗭Z\cGؓyǯMOW[%5nE=){9}+jl,Gqy'-p?7nZ`jag8-G(sϢn/3|t$lZՀ\Ǘ"{6I]9L'3o\sZ}s+}蛾oH>y%q~LǑ _ ?teī^{P~;.P˓KL="V.=45ط)&]>䭹ǀ#_fZ:;ye]K*wE|?R W}9땤-}6;Eㅒ̦Gvc6{Kz*O~W&d0~]|ւlLtRq~g:NdRΑbҏ2G,roti-P|W$(v g~z`9bƓQ.|ot=-Y+ݬse=lW$oa +C7 [bVZy`}oӢ#tl^/>6t3^ =_K^}ΤgMj?J8z`񮲻{n1}9yuKbe֥ԝOl/P4J޾M=cGq_JP践b.L׮y[q{vԱ* -4=HcwE"XKיUuQ>~!ժP&.']=Nd[ɋ4>4}#}cʇ:{)@3밿aRZWUKtrt[n!*tTrERGn FϺl(xLoVç;8}8"D7؝3`tYGN.Cwč7v(}rdh=_L[m8tYZeuVQ+qzN<(L?t#Pw)]-۶|zǺݴ7p7>z=p|ͷχ+]flS;osPH1r1mpY6m!Kb[t]rj ?؛z5$8Ɂx3uڿS^.kEo4&\Zimo]ir4TDcm syľl[{ЍlI e~+/B3oz?+FrϛY.Gja0{G v {$s: ԪNjaM?$ch+^iTRDkSc vD$XkE`ϲnllAU\b9W7]P0e#%g5YwT.()̖6̚e!E:ȑ>JȨ{q poI,ggwL_> 74'suY+<ܫ">vq~~ɣ 6 ktLdD)wqnT.*Qa])>qYyCBTa%&٬f6ǘsNN_ -5[鎞pdzB< T'w};gAg*4vio(6Lȼ[`eTgOx2)򴲢)ָ›ɹ'賷]S"触몞nbl>ro%)iVa ;t)xJbMF={M6 zW]R삧YMx%e{Ur*l?NvI S&,]ο}]:W~ 1_П#7yV[5-4K(#K-6Wsĵ1:=v u16uV'ɍ Fw}}&[vP;/O>#H· JQ|?VK^6N|y]5_Dߘ`컨J{д(k>5 LJoce[]o$[Vwgd虯9DwHU9AKʂ3t̗UsDWO\`:dkϖ$>!5C++o]_׽AsvkeH}TneǗN ,=bȪ^+㫽Pk_DzT{'n ;bǐԤ9ڧD3ZD3%<9}ɘOkgmz>ի|*7jM_ϸ ɟ8}!Yd2Y>5YHiBoN6hd6(+y*הl-H!m_BN_!d* ^ܟj h|Qr#q^LПt 'tCS95_{ɗ{5=H'?tj$ҩu' j{l싸e9#F{LH>d߆[fv4v"ż!InF\Lbx'>hmQ-+oxŲjЀDΝ(DnMBo|vRjMMC.5~XWrcȍ}8dtTWw"=gf|.e"wvE7I7z'i3eΜ'.k|“Kk 6Krȇ2|2T)$v./ J]N`8y3_죋SV<#ګ>(Ce!O ɧ/.Cƣ -Jkz0jzN'/dQQPRzH% .~ߧ񣅴? ПQ_ǜuן/'t>l#rc 3=ӌ ->5KeO3X?qiMp;n,Xv(.ҥdsZfTybZ]ec+OX# RCv,mȲ^Sh{״SLϚ1RwG‡fEb:=ZbqڽY5 =hsϩlVݪ>^Y!xAaqQVB@, "m_b/pOΦtxX!E|ęU ü Zs%㚳D†P@|C|ٯ>zzD[-mrXȳvd.n~rh?ue{Jmpih@8 5n}=+ |^{DJ}CNp顭,ct{bgg! )q4Q\LEӨnpQ|^IN_)17=~n0!͍s*<ݵ ^uZܳkQ]t);Q*>csZ"o&y3v o=.MdJ qo)E\yiZ箵NԇQ|h3 FK]q\Pg5|wwOu)/7Jgčrmwް,:L{'}l"b.(IߕMI±}N~/ӰrRǬ]u6^?fT9yV|*kF^4jy]ed?U,u'TAQ`ʘ-&*09Mmtkܓfehf`:ka 'aeݡO_6[߳5<-wRO\|x|#P|T֯fX_b4NnDɏפ'k']8Ld:ꓤY`bmF@WɄ^Sn:;F}g([mnK"zc)C.N)u||_7kOd._{C;^i)DI/Y8Ba vRs^,z䗶ܲ "qr{#c12Oף)븯^5w{9N=ֹ-Kۯez`5}WoC?{ kr -[v_dpDߢ$/mMqi14'ZNཻhJؕe>_/EV;=wbǿmH$(Q"@Drt5~2m}E3.[ޙ}wЀ[)mx+s]2=r"Kwf'#?%{ڴqȘptֿzsTYwb0م7- =w9alm_u^Oq壞`ǺgkY=B?knEcx7Irt|s4J7 'cf77]ZV{\79^gPb}[Hoi_M었!GM, $5s 腐 vU@Ϲ,7#=F#gq yS+v6gK[BwDEg4k(@+|Sa/g;z*),?݇( $VVaLVSٯxh=&cy91=4utl#:[LGr+_+^rA'ik99|3.Nа$]lC2 t $:L'a#s}O?4H[2jEhnv.?o0Ǣ@R ~̧$NM."~.iAd9T TԌFs3:3[Һuzkk ~+)%#.6yjBVb/l&0g<=@A]%ر.WL76 H{p2'8 .<5Lni-qnNhcZiu\c&I&Gx'[V]EuY/>* )X{]cwg.]bڭrS__.fwA}ײ?n&Uns8ߎ#GD=Iw&[{ g{5H/MD Tv3!3WI]bvx{_ܶ"Y*ݨv<[EOl~NS h'40~yjss;m'0'[]ݣRsy̓^s\h0ƒ 4ϯNwMffMYUA^e4[)ENglؑ"H:ujG0=w#k?.({R xty۴R=xJٸEGsϔ,m5P{5<WMY}%iI uW^ }>MN d[t8瞰؀0n%nwY65h).iy˧ռ}=d p[Hʰ-FD,q.> +nj_We'trgp۾N=oiS07Ulqb$gb+<܅/({b0$J8m VOL3 a#u|v.S_ˆۼʏ-֫'RIfua)x 'g H3^yNCqл/3oh1u[9OƨUÈB%6+oyܖO2/VIX) =H9R}kհWQՕO1G88in 1Jw藪B ͕ "#'~޿;}dmDZ[OXr%p[3SK=%Ӈ5r,>$ e&fgkeW>3)r藉K!Kևzs渆Z<_{"G-'uIVkǒw޽"WXKUx}/L8 &zq_Se̳E8U `R-k'n͖g Nje^6tCc҃'J3uBts . )C/_+^9~/70åeH2 OK/Tf`DkƦW[}װdԳgnJ-GDҿwa;_-9Z}AT̍Eڙ{KXdy JD|z7+$rom[g|yB2 y!&7ֵɚ0"j7߼(س ћEW<5* e-},w0ğ]C58R3RN9gOf,<u^lto/^ Snq Pty+ĥ&ۡiSK_ƾoJgɵYyicjofaauU#`Z49^ {Òfڲ Sɮ)sS=%=Kۼ8n15>ugūI;~n/>kC}1\_>띛?9a_NcIoj6((_AaӽC^ߢaft9\K2mOܣ:7Ónr5y_nBrOɿO2fu񡐨XlGnX;fx޵c Cព7܋]^yߤvtL"ϯ9 ʬ)u+Y[{[K:Dhw֖^ҽŌ훔 TZտB,~4~./Ya%r٨J{Y޻_`T9sk% FB }yrՊ zpl7,39nۻ<eS ʇւ=Ӛx!N|W{˩\TqO8~+FLKݧbwz}«w6/Z{78nz8 ~M90n .oBƌ>׊WbzR&.?քuo-Ty[?zn:0{xߎc?39Nmlۇf4ڡ#_q{Jk-y w+K/ o.&+y.zzϸluy34c*|eS4[M\2wwLN\ XSua~BS|?$da>S/>Ӷ^eKjQsuTy_W.lX9Lt$}mgj:+U^x)վqO'l7׌oa0}ۢb{;tl v0U8{J_['sn>N,UGxewq}pmm4 /qLۏ~8ݣ1.0U^Mjge7AKW#i>%Ɓ[TGxe 3[kuw*w|lTu[G> RmyS3vJIdjlln HUgB]å^v;Nέ'h-AϢ"r Pp̆iwOrxһ|yQqR{E 3%yʤrz*gϼͮtq*2/}H~fIvKt>HeF9Zj.Ij7ܐͱүG\)Mlp4#ִt-f &[usɋp%Ko4-dlN6UU⛢QE{7?EiiZD8ʪݲr-\7J)d__oE <&|7(V{Y+f킫hY db}V?]Wނ>x[@-jqpvztI7^?nRh)cs=]s{#?M\묄?s4{]~c׺p6vAs%ɫKj xpf?W8`8^_av8ɷ_7 kH`pj_Z*&T09mTYNXᦆ{ 1NÇ no=HsRj{_}L(P(N]oVDƚ5V=1e˝C5 aCn5I4}/{d)!nN/kW;?'>VbSd^ϭ_&J/{ꦄ}Lz*4*GMkw[M3:^(=PXBTVzx%zn`r$i~烘&V'}O)YU 4\WOT6.E6#x!ߓ! #d>0a<0k ^|OUk?~W^$ ]^d`(º( M;p/B=t|ߴK-H~%}Ys|vQG !jkb:=,zTg" +,bxFmz֗֗*!NyS):G9Άz<(%Zg n@a^c^iDSfcHZ¬ihe3lX}T_*0ŋ}o}<.הNJ3UNmް[TFN ^v  ?mBMm"S ڻrd/֦h~Pdi֧#ΑkW:,zj⡽#ק{4g?Xk0+74wkݱMm͗$ &m3\p|U¶Lf4㹛x0ߨ3ya{ 9ݨ|zSbsw)_4P_aL`EM合k>Cn|\[L߇}˺`"~yx{~M~v֏{6Sk>ٳϱCzn%sGajsW+D-n1j")ηorͪr36s)gSs}1S)bNOSn0JePĞetӇ*o,~m(0bdmE3)k??O+Lqw|E߉-OHo<ɛ(rkGzo=ӖR9եgBlׯo }]\-5W0մBIˏLk]4@/S(EU]Ke]m=*e<1GTب e蘙PuU.ިcHwD]AaK驢Tv4IKΝ K~ɡ.i9}Cwr]G!hwѓC^o3Mk/i|5o|}2=[x,x9)ŇS_K<[>躛?m=b [(aݘPKm5Դƃ%)j7f?I8 t3wꩼۛ…}5ШgZ,{0O,L[D-tA'p[Tf1JTdN>=vip@KنZ[L(+2w l|YF`ؼbʈ{FfI]1c88)T2WӷJ\k9xy:7{tI{ՃSuBWFXoTɪ}pYy](Np'7}ӌ\ ` ަCP2j>2uHi>urDJWbΌvֺ6vcAm8y.㱧o6?\dk#"Ӷ̵waq.#aGDŽyrki[M+< |zHB<TQ|KɕqUOAw1鍞x\[kiG#Q&2>13rL }^ԍ桛p⭋"b}|1ݬ/* 촉?wC=o]\9y,WXa 7QyNtV<>YyԙG2jW^+>w+P|,?z4b![תXz%i춑h׶WK?{.5^?s@尩[q{)bOh29m*[S\u1v\V-7߹:~2gZε@QQir@Qg߈ldͪ!^f's bJPUn7:yNϡ/otZG̷؃:C{EڪH; 5&<ShCN 7T*LR(BjHr,>Ȳ-:sZ}QحJA:٭om2-cs~mߪa%S~ozHGǧM;^8wo?]d~ XwáLuN0}0[{zgZU& Ś2xԓG?##u˖ǏwlsU7Y7_33g}I-Q%!g|TpL.0@]+z"_.춓{8U`_`tfAA2E^JtJG/._+5shpŽegЧx)}w!7c7J<)/;ʃK*U7[/Rplp&Tv>rN8& G< ?LN^Z7ٵ'ǪΓڴIMJ^O\~/鵍J xנ6M,TyIC#%&U;meI]#\XS+,d[YOât5ii)=*[R Wyy8l%Wl4.j{$K$iMur׵MjV;/[]nKT'<2ǚӵ<70zݖ*w2 A:݆vذ;ۊؙ3LTA/}Uo{/va׍8Ա-6&{34u )p\:(|} =$M ;nFoN DTow漑 +_K26BbJTLDtmijnRO*ñD&xHP:$}H34Sd/ "3s+K ;nO*Ҷ;`(UGs*!-CaSub̴jJkxhL$T+tԽ~BLFHP67)/:Vnu^ Ft-^%jzX-:K㕗X n"јdtJdSi|XgIoX˅J)uf?VJd5i[g&3:Y(ޥmmiXhpH!>֨ݩSд0-a([ٱ RՋ)Px]}5nyn'#k$.s2=4 sn}{aGK7M>J͊,5<ݷ0).ԁmM3O"W_Oꨳ2qy*-j'LMiGB+Ǖu&B\TSuޣV+Iu+;±nF&^7"~66.rOsEfY:OpQ,.˲S=X\dr\[Kwu9U>}˶CZ=ِ7تis~d˼s6WJ\O Tt(%+&˛&Z]t rG%<ʴdtgi ٿ=s$^ US6̩ ޸\UM8Lgi5YG-3k)mGf;F3zacBCÕ1V yn5ʪ}!2bܻd㽧%z@ϺܺXr7gX:5҆l:pPxjN*: G֞W[\j`Lօ9YQQWivcF;Vy=oQzk`-zM 7dk̰ Y/ -_4}}Yq&Nd?"{ 62Vljz"]ZLj`Fiuf. +Җ#w#hӭK6'?V2rV@FL7Cfq{nG;evR>n w~qݦ1J&ϫjAuČ@m))|ęO.r9߽65*_.[Y9U}>%`{6P.yykZPo|{}V]9;ޓ,eoFV ߝ`fE8٢,&v[cQђ{Rqn,;$m?{{j|{'ԥ>&Ir*:2cN e{e )*rpu}|A8 L};o& J 5IĜUz킕ҚƐN l9u;lhnk{DCtf:yU룎D;CLח z~Lt}oo.xitvgr')i=z)WcPo>Se( y#`r;Gnkh߹?ֽun3;l(O5;ym-WYF]a:,g1y}36 F$5x]r=F)?@]&uŎU8S6Z\7O9`QS|sL?g%>ʙUFbVaUm_o U‰l+ )3 Bw.X&?n=FN۵JǩKv0 2Byɔ,&:5eYZ=)|G֖34['$9M6IA%oL}fٳGD]jYDlNa>tBl`Ƚx#XNCz7X<ˎE/0U,] s5X%S{}4a׵Ot .JSfah7=+ czǛK}~UiԚb~PR9~ a<[5dCyBç} #k6)c[kX&U'AEM;e/zɇq}7!"[,in4Y!v97;Mû>eLO%dG?A̒h)nqw\fNBy]Qld=li6WF t?*ҧ+b7R"8;N'_KTk$*rb[1YSNcin9\P]=7{e)gN<F,Lx(x͙9(fjp^V4m7Sd.Cfgf[\Idr=ECiut)Z߉<8jJ~|/nb˚ &5aRECn5Nɮ;.M[(@5|fkn\K?>2գ~Jfe#Gm'0T׸󑽡5J9=BʌSg?Ds_;|-攋])*.X\ ͅm}.Apz|5czB #Sn*"&JM3KeٍC\uKP J:nHNA\Q}& PtyEv*l0LyC_hcD no!JX)Vj4JVZ()U>y]JG|27]N.5Lxp"{6-.=){ўX!݌d=س\atisEnJ3pMάҵ&1ލOXV[Q"509)JL)ؓ;kD8xIBaɫ%Z"BT ^J+K?**)PH)%m/tߛJ;fT[$ ZV^kWZTsTm=O~=uS7>6!ո>5ljw>/7LP\QN9ֵ5*Ce1p$+rdWm[mQ7ʋfEPQR,ҝ,P7JНd̽reRfy]5UI5ZX앴ƕl;fnH+{t=T ~V M_ypCF"gnu&;Nqk 0#Ƈ=:;P Q( ;R ?tb޾"g!VXa/2vPu* CqӋ7jaQ? 56050qN,"eJLkn06iK=i4i#`sgH=_c=Vd^-~vz&n,7XS`2)a;[F7I:*+l1yS}'_gȔtm(4˪Rflfu&.*[&QIc2gO^e/2nb7ak;^$vqp7 ]v9kP94"&6 {Uʛ;&a:b10ka{1σnmi'DE}TBoV6`*)<^'mW)8:i`Nbé-_<}MupԓPo\'.TW>WqE'SI}:B3؀Hl4N"!_ac_O FUߞ,oPՍpav8BpC{`hZt 'p谠 4!R246 b[;C&@6Dx;I .N ˄am8"'%Apw7#t$00Fm> dqD\ k y#X8l> ~`\^DoysXHu͞E%MMq!!8 EAa8a0(6M ƁBano!1 (^MG[DBVW ~"8c-P áz` 81B9 8(0iX`6iIƉ @л!4iMM W qaLHo$׉8`z!J%Z#¿HpY6, 넠dFRCDGEHpF$X e$ hYޖXO& 3qd#@Dˆ'-o8z`vvmr;P" *Cݽ(@X(X*v8ϠPF%f>#@L8w"hr|oF/8p`= `B9_D'ҞHn7!!l?5W{32 뙂 cZ[0c870V gc`3 \"xm0cxV2Dg1` {1B` >Ƃ`26y`2' 6`L9 ny`%s >?`l;؁q aHPbHc"AM'i<Ԥ1#(I%E4R|H1^K()J$Hc!-H?)FHc%A4VURI1 J'=R<H>~ R:RLHq`"w'/;_]Wc&g*2&c2%c:}=|_낅`'NXCZܤ5CK|ÿS7AҞ"qaҾ~nio3 >R`L>L P va9jAd-AӁHЃGr0:)H\i&iFR ~P#5zX@f2#)`&,@0a 9s^ 0?`ABk\Ft3!&I|(HcCā1? x `N[0:0,023a iS"w}6PZ o=ϙlZ`D:XA mF"ˀĂ.y&fBd@Ag); :0>f]@B00:m|xN V,HD/t:`ئ:<=1=nk>p]245ۀ&ݱ^Džy~ὃ[&>(ܾተ{0VLLH䃥& .ĽKN A{Z`F7cuCj'F( C;oB\0,bq9)Oɇ~nMВQbQRw*****D=HdjBL~9D- j@T,58wk4@g4+d0C^P&,jt !9$7;4 X!`[0~?Pv"® POk$0AdXJJJJJJJ/:(*******!Izz(ARb¿)\(H@~DAf*( 'H$GryoAVfAAzP,7]deCG`< e$+Ғm er0w̾!ď\rv & TJֿ¯ |I/fdN^EA6A^Q064,EQ |XhP?rf(c@lįɢI!#x¯B 'D=GP"((j*!j3 Abfxxtl>_B*!O&Gz6888/ 6 #,FTKMSQYNKSSxnb.en%hdnlJTmo6|㯮I5w{ t?<88p!#A`<{7~@2 v(9w-rvh1jSlK\?~Hb~Au$fQ@+<7A6RϾb~?O8G ?wmr"QRP2RW6ST3DS%9MsHT4R2Q3bW[ct߸vGҴw3z߷z?mtcw#CK]tTŹ!A=]{bjBldQPdo6+nH {hg|+XQZTZoBS(*%o曙;s y3wf7|f7YYYYYYYYYe#oL&\|G/'ϺF8BS.N'.I'8N':o;M:;K$نWl^/NC,(> ˭Ɏm.J-7ǑmkHێyc's,vcNm[s"m>v$%ېok7"[M-nfjtYeQN?rS5Q;x.pL"{]pCYaN)p)M$a\iNNo~;yD/ND:hcj8!pz63Giؘ@be <hh pUh q`ȃ{X, B\C;nYL\s;r#9Ԍ5P=h"+ց5":@ @%b\ict.BЕfg=JmtfKiȍ^UW1.sj~$^@YR vHs.@ 2V {<.S1N$79d;kpY6!{g 5uVnqIanw]/F ,k1$+NowN &Id A|ܷh1!+]+c/c>hZ)umKUzv㎫zD\Ԭħi4TC#@'G>mXzL9kʬVBcjzXY4|{Rܦ,Q~ȱM3~|ߒx7O/AZe"2eDb+~Y1SGh'}b6y\r]o[ sDebp/ );17+KbS1`_IXGP*{9*+hX1 ^KX W26^r[1 _IWy^e G@#-+z1wAcf&OBGż5^y(}wN+ڕ1!嗸O{av dy/ks&3|` u`2XUџ9d96̌4Pd5z6`?,nǏ!"SHE?e%1ܯ p HR/HxNay: vHHjpi8G5C1vB)- ?44loZ q.j-&r- Ԉ%}1UӯKD.(x>LkrOSnŘ hcR]"iLޯc7ԧ 4#_gH~-yƤy3^e `FP8>y'As–ȓ&zߑO,PPEKRUܭ#),mAH Vqgf7*1 jO:]@NUC?a\JD?l?1AOKbM+@@Qܢ| 8huTB'D6 "-j\ qNu3 _" !\?ي4A)9  p*JVʼnVckO,^lq6ڏra@m7FѢaiT||~sb=V/i46'mbZFwM^vv `W֚Kn%ɳ~T73X^M/|߄ʌ(nd[#b4쬜n_Evd-.[ ~) J[[ lL}(JDL.voo'OgKIք%j줜ٞ!-I=&C̚P_.Ƹ|~qx 2Q2ԾjuXLZl^z#[ ehIJŇ$EA 4m5B!؛F qN'LvdANŹdl݀2bK6"8v1>Fv[̇Tk:K܆y2/uպ(gSyҙץK5.ig`/jik`j v, 3 tz(u~5KЮI;B4[;Hꂝ)~2z3_Cp{%(Ѡ9qUgo P]n-O{=u[̃TOf4?h;c'LsYw@ WM$9 χ)aJ+P~gUĞQ>kugt7ؗoE"3/9vI*'h҂lo^A̟󫒏s )]K5{F>}ψ{y!v?)7JOlu_coU[J5Kc(ho䁾PKf}|Q%W0ap_7k7AVQ"&;mpK\qf̴pL3QtZR$HEa;k 本[~}Vu /ňda'A/5h)[T9^6j]ojiY8 M?OH4a$pd7d54҈6 ػ.(qIrұ/,D"̃=X 8fOk ~.ֻ@g-YC7jBlɳ!FZ,;BF~k@-a ŧҲ:h$I "ztl ^yA69G%3;~;]RY{U|c9*G=zb }YjMg޹_DP~`syY]^e$cil4njm6Fa;1V >p$=*G֍-> (q93L{q@5XLCbHvYbc{HLk,ܷ|]c汘߮{pw:YkSᲱ12.^rM5f̊lDH>c2vY.땻skr7peȵ~ErvNA~ns#A$O75Oh0SÈO}7RSwQS6㺫O'~mh;«Kݗ6ݻt`_=;vXaScd'4#zO_Y ٴÅ)*ݱopEm(.MJi شu~M4mGVJf,}ӖW}[O^pϼcڎ=.4d/]S{]^V6]38i`;+یXvok7ZKcB3zt{{9 23eۉ3a3wt^e^c Ȗ9j`؄n<ֲָ3}>w3/?ׇot!lx/;1Z|S~uOg]=U-vvX8}ft|8߄d8{;{?1P/N?[G}8urP-$oK ˯;i:Cikmr\9^\o~&?'̯36B}[ΣUNN&o;/8߆ϵ6tZ;dV4qNq8~?um̿p#6YXImLm|o36O6UCj#'6lط|ژ m9@R㠍Xb,p6f Vm{sѴ"tHdR%eEpz]ɪF|Tc|?4Aq!G$yl͘<֏'YNcTgWeѷŰC5VƣY{KTW7zpt>;|=%4_Em zနW„/yըR$? ¦BtwYmy@$H(eNuH_=3#]A=B =^C_n㸵^ CN|1Uй 23c^^ZvԪ H+;[U?SPX֖U:]eBG1p:E,hUcywZH۟HHZd*j+=1ZՐy͒To!^Vg/v`yDǎ>O;]݌"$K~d,O7Iۉ<JpփZWL0[=`s=z剺ku/j)B"cN K M GRm܆\y|qi~/Y9]xbd4k}cX }y/>=}UX]e~OV;-9[ zSs|m,WZn9V c7Dym/}sLyP\F|~Zֆ㪆 w]'|^[E}n$:1<,/bX\k`G[9]2n_xw4?3J[ZQ ]Aqt2妣0j=E @] ! #EǏG]~<_&G(pWdZ$kj;zz&\7lƛCm\B Ġ vG6v@5.֬Ƥ/Up=;3١կ+yZi φ|v ѷPCj\W1je= 07Ǻ0qb6gol2Y\yݒj:U*ȯo [[tZ (?=yd-[)#聏I#h=%M{eJ?*V_L8d7;EnH^nw>)Ow<-eN`'kv;xG Nɮ'NJҝ˄ $gϓc5LJR>gt%D)TyqWu4ֲ}12y]ooqg}&pvLXHHr%$֔ƨ.qU\5sN5 Sn.%-ihYR U|@RSJTA*4! m{o޼ݹ*F?no7?ogΤ ejL`{b"+5{>X*n';ExD8[&3:\jRu:UWh6YRUk_lOܷ֫z5vg*NWc1~ E ٠ea Wmۖyy qpQ5nͪM-9,ӎ)1\JUpCM7,熅BFBq`7V unu&U7C֍ tc-UƄ%ݨŵuk#:um%Ztm#zឪom'ݸŵ"sn{E9.>bqrX%Z={tWY\[Q^$]*%}FS?U>&ˤu3q^%y\XHa8/^e1Rě457x(~[/]ޓ#xzJMS$xvf$uC3mUrn^Fq?#0Z!z2xQ,^:r`9xq:WUvNNV4o `4uN?2__I['FóחXbug%73>s׽޷׋hV=ۍR7FߖwnvmyQ|[ts7޸q>1z/0v3^d"7R}~kR2^c|1.ua/~8?Q-M6R?p+F}YJ1E' \D$8Ǎv]ӎ34<#Z63ycK1.F18ɘ`u\5g\_9X5i\kG/tƹp\F eF[m>Z[Bzım@NE?9hc iJq{;08 k@ 0\,A> \cp}Z \@p0Hu[I>d}Z4qA%1(H@l` >>m+ߗbX~&W|_?gp}!RW!Dm*8qbZ7m|~̠/G|£I>!}A\F ~t-ɲyX$,nb͗`DTxkD Q~'0^GT,.oP0jJ+`HZs*/OTkޥRa?d rU z}bةjvn.SlM}y)G9]gj|[;eX~f36ZelV ~~G n-#>5Wg“նqz~m:Oof)cegy_,[I~o'ug/-x3?'LY~雚C4&u*oktם?Lw{;6VW k&̑n`u^|wGq "5׍{ r}"uV};[wMd?]w{:|#|í{ @qmVЧ3No VL M*XAjNX:iS>'dOA!Mv>d+A; MvִLb9幋W>|Gi#5[)RU4-%Zм3' Qo?/<眙{f7sh%iw_[u'ޭ"DTTPp}"ze~N5pLr5$ jVkz *TGX$t*2_Fǘ"^㄰ ǮTH\[K 4xXOUo[JYJ6Oy:]8ĺlz@[OtuOx̱5 |tU5gIv\&+=ȶ,֎7?$ھv]3!Z^[7+9_!tmԶmq+ %jhvώ"UZś#9ؿJkeYMrꗏC1~kSo9uZ9t{~k $mRuu5c{t㔺j|}Yۉ[(Sll+k5>P\Vth [**w!J-&S=֭tՆ[zou<>m穽bDay=|~Y>}z`p{8L,v'ge['q+fMmeG>c|uQ3mN-&UQ_.S~{OZP3/5[7ƾ; ,y,ٵnǞCrG_\9~s"Oy=BGh9E>H"OgooZ]=R/W.2l%1-!wI}0iBC#4'F }֠%BG 4d 1g0)H3kN04=f&X +I˦HcdUy-Q<1np; w=po@Wh<OSt< {yٳ6 g!3Hք`Y{֙uvŲdi6V\m/RW!ϓOYʓ,zUDѓ( =jQ}$# (-A/(͕Jbh x# OJ.H{˸gQVդuh= B1et| e\Ǹm KvP  `_p!\M0R&Ց"$c4]+-J/ 57\]%7SILy|Q.UAOsԩjڣ7ơiZ.7YC%t=B?y|vf{G;]3S gc:rxfr 4EkqP&z ,alq# mqGwǽpCp T<ǻ%mx B#"SrcW8@F]Ɉ1^1s\7TSR#lF8o֋N^6%Yóٛ7V뮏ԃe !+I.l$3 #)mGɚs d VʔW fkmX,+봕mr+ܗoZXwEk`/4zFSlU:j[2-@y'rYqҐ$U$!OOqz,]}rΎD/tzl@{g'S79y5o?Db 6SY9}C*C|&լϬO=.<OoῤCRt] ++5rsA)Wgi+}ȤK֑=|dHzn40^O;e I3Rg뜭bs|Z!S$ EySz4!_N-2DSkmL-/DA!Ǖv%FUok0]=4ѣoiK:rNz>qBFT> d y~, 8+ hn5 !-xlXy88 Oz06KP;Yk&BL,U)(J\V~WBT6W;CuX]nTYe55Zk]Z6Rz}^[slc':a qkm Ijh60VtP,OGCe2[c(Bd#0i{EZsE=3'ae|WʪC1vJF;].k gFz33(nrkÓ G KRrF~SB*WFAW6 VlpvL_Kh:)lu:I۪CdԤ*uXg[!VUժnRǪgAZmscg`p;|v=ِ-Xn.GNrW|C-]rERǩ9j%mI3^7Jgzjn7?33u(5MWC gic֝ b7V"(0>W= hQZ7m/oIƛZ^[*k4N $a9#U 27˚DŽV%YE,DžFV31>h Rgf{ gmpZcc1 aW@8!4&PFW#; z9Rփ3s Ԓa+<MԦjӵY;{egkVc;̞7{(<`Q op0,tu!. Bܪ/.媲Z/\oܣЏ_<)GostpE\vm,ÑiòwTh5kf֚RTR,R3L*MJ2KL-J+SJ2JL2*L+SJR**J,K24SS3*+-2*5k]{:};\Ag^3`r㪕u6s/o >v(xk!ec|y ՞< 'nVᨧHbXw"O 6c 賹QL<)ϊEN"^o[6nO|.qT(NSl)f9輭\k_tc ʇzUЏ03|y| }ɯc& )|OB[G^]kZ.ᛱ`Ok~4OYݡ%9RCz d|!^~~=[B$".NP;?F @54v1k98u+' y4?ӺEv>>>fӑs,9BBFq1Xft2ZMG46MbmFXuUE{z DhQ,vboiȤ7ٙЖ<m]߽-rWGn[yyޛ6_ "xD4s4\C';K> b6|/y%bN3wߚ7[]}xqx ɰ"/S=C'[:ڹԹ{:jF7@jԣгWU3=yBr\Ͻyn{{>U^nqc^abk_x>"IdFc/xՠEpŝKb Tv}![%d)u6":YS{bkڊ:8jQ"^^$ )dkMvO'_Zzin~EW}pݖnM'{ x?49"8ھ y"{GH{\o܏\A?%Cn;(hF)(gYz˽A ?xBmw$W g%GI_2<>K@٧$vګnM_Y3ދ~~! dӇ4vnʶ@CvP}ma&ʻXWX{M7B7K ͡eݡa+ܗrW{]?Gz? aMJwi=f3eyKBM?_mf{kuA+VcB&vqԮp,G9W9H;TBEh;鞚z2(7}>N|gV? |AoL'8\<SI5MI4t82q4.l7Je^cN1R`Ap1PQO4,u{!Fz1^+tQooww6z_z}rAfn\Ҋ$1d &;d;9N:C1n6juP%+7ט5z: ^d_V֞m?i@vu:88/{U5"~{ڍ:yOyw/M 3P}$D6%{h5hvE7+8Ԝy,Ah+:5Ip9B-s 0k?`?]}05T"2=Z{z | gQҟ VnB6ؽi֋ &fk 2VE7 ng#h?GH}~ޭ?58PLen(AΔtz+L/ڟV'|ng%ZtkE$ ;Yp~vJuPno7 9A(:~{Mڐgc,>pA.ͽ'v~񈨃Fxal' \ v' r9j ߻xOV_#N`=B,=Gߧ'tV)|?c>ǡ n3mvp;?.r{&W Nu׸w5v.^exY س䰀(Ge|InO8~vkdJ;1Cubgs .Mfn]*{ȹXG=w, xd+}?b36' }>kz0com,x5%DY$xvD&I5Qv$ *O^.G!\/o3Ѝ cHZA+?r= پ3͹Y9:JVQ`ZS~Q w[zzv7$p]+2~u6Qw-hz9<8L ;N/O ׁXtdscn5im1i$SCy3QݢCR:Q\}n;nbT}AݏAPs|^ .a>uQo~BǸN 4/$(R^]삗*:C=]^V/A TjkvKLU 8߬4t:rޭTC:uRZO>8+߳SU U7@Ho5 P홟{A5_]=Rn@w$x4||ftoX$BB/60 "+ vNx{hRDjw7Ey_yrf'[>d[OL4Ggd^#p-/ maz* !}6{&mJwrobf,;` 4j*Ysvܙqd>dcq+ED @b}03yld5 ?1gqn53϶dZ˭,CG D{>jh@ݜD;9 + v839xP1dǮp^h"}HUO~(-2x^$w-H[҉$E\DJ2&FRvz1k"8z;0#.iitdӡOK+zj'zȌ.Csz;|#'/՘I_Yb-?/ e#s{*gnzkg]x&2a-^[ bxF W.{)PPRv`9>'R܆М%qwez6zЛ)3(vc9>d{jej̮#V:{fBj0~BwqǺI^*K \d6$2l>Φt-fve+WaQcWL '9) / 20{V{*J:cs PKiS ?BN!q}/I7r#pݠ#PqdFO.o|W|!~d3P^+$km`o̴<25,_&.o0qԤx5*yΓ gS톪"shFcцƲ.;rBoς|:}||ݼZl=ghY["<N"ҙiƺoEǿS`g?Yl[Naok.9CrE9n1}]tUר)A{Ȓgrh̆=kҗARIϑ|gGYD+0TH٢|T!/Ʈޢޙo`g[I1 #O/Cah ւK?lns:`}h0n Rx-)QK-0sḿݫv@{xj׫@H\Pj{{n230yct5.|?loXoZ[Zg *&4p֗nT=U^:+.C>QGܕ_0V{>}͸3kKZD'Qz}>F Hoзо=s P?>/A|M̑Vu5c]!RRq@t=|t$Ѳ^P[@۩B |K7o/["+rHK;@t^﻽BI'HzϧPs )::yt)HiAOWƼb*x|1xWqzUCŵt-r\*MH~àS\xyp2I_L wBkt.Ě- 5< ~p=߻{{ nZ]Fv>e25+l `x.ּ\`^ w]+r2;?sm MvhPjk6機T3tY 3wAgtGX\3:N+~laҦD2,CjeW׃^1ډ2ڗބ~\@;Poh Į`cfJlՁӻ#MP)hfw0; fD9l7GWcITC36sto[$"ʉrv/ڎ :R#UZ Y F/kA.݃?튚k;= ?߉l0fQ5}X x#stE5]8W@˵GgVs9SA~4NhSڂ[Qwoa^ihFнݐ½{tvy#:#c*Tt[鮠3L/"~V{BQ<ٸN+6=ɕfU.BQAj%t#Ӊ,gHc'FS=STLڢ>^ ~zz{;}}Vs{-w~/_}QP[{Nཟ]} 2d&w'tFpQ f:6q4:D1 BdsvE8θuټ6+ݚnX"UZ;K6 g[+Ζ$p#rd]{=ƾɞ^| 95}_r;X*+MVmT;?#tgFS溠!g Ω!=/&ϐW@:Nw^t'h4`^1sy;~!a?sB|+˿gi*%mPuTp?1ٞt/Q܉4í&*Q!R2イ'n]ЪϞàQC!c৹t>A ?i?@U=ׂUPS\ L1u>̄3Oϛ̻ =B1n}=>$ۡTzyaVt6]go7?t/gYF&Wg3Nҁt<͠i&u&ͦs r`xAg2f`2Op>BtsH4d#l 7FF,0&F16FoFX~+1J2ܨ06F>65A8C8!Ah4-i,mv3Or@y4w-nn+Cc$ (bXKڱ8R`[ߞ2Y/d5\Y+DJ_VbVJY+nbmg^dCOQy+Aۑjغ$fՙ̓fȊh+jiZ8+J@!yܓh%YV5nR68?suCv5O!R kig{}Q[tk뷺g #34KdIdZX|V3RN5% 5 ˃'OT x/&zxϰnyF9eSc?ߩ)2"U`1w<{`KR1 i&擃gE{aKefrm`U2Z%8m/$Ń8h,ᠰq L\W6 Υ5 Z.xqRɟy|+J߱5 0XUВCБ@=FbNdLq@0J\@(: Qd$H/pOk8C[ufq{_xg~.V:L@X~ԏQ?G~ԏQ?G~ԏQ?GS.25CK= pevkGJlcc99|,."lQv,9vkKEZ[JY}wIAq^^ Si37%49ô3LC{L`6؝%c]IMw&}?e%D9KJJؐ",ֵGcP-?$HFgsY !%A4 %0=%tw"UV?bi";w[:&`K~)f* 'ĐZJuJwy[=[7y7y7y66477mݼTZ6f;؉zBa99,Fb!Zۓé$JfoW269zu'áki`ֵ  a 4i3Ҽ\DEYHIa^Xe91Ƹڻ:xZ/|RGFF1НNg89-. #"c7uT3 U# j6Q8t$$"$HHb/1cR$9hgI0~'֯D≥SᨵXb^E+3&W<EBǜDRp =˼~@zF h")1YLwy4 hizgq ^ǚ6p A2ʛs+=`ljli'6oӔ(]i^hpzl`o`d^egPeVKCV%)g8fTPVAؠpR"r2Bp:|d7/[)\C<!CBh0@vٵ>n s\D7/)+n6z$9,‚X r=Su6[k?KC) 5Z- E /&#IL /`<Х448x㙖=Z/+yInˀ4x1p̝,ٝ vg_%HAB>yY`f?β:]qB#B#b_`U 59'R+v!z:߷ u ޏq7&<(ӝ\'E+7o%/|>IQúAiysܣHEJ,vi9>`bZH:e1Fu5+x+VkZVkZVkZs-< #  m(#nxW"Ǖ}7tL{jJ>c iS j}2!'8O|8<;R|`пv@|K>`/@!^{66((D!v4T^G4 ?[ʙ_ ،w YNw:VU_|>ɣk/:Z˖ 4&LixzG j )&Rw!y̰nQCP<ʭCNwIgmK)Qj˗۞HE-#e>Q/;2Ǻ"mm"Ib8J١㷎uIqt#&E:brRAv|9'Bg'Scm:_rx8FLFֵ]zuq{==;<{|m}[X9_ly]^ї _.M&3bB\+u򻯓vRw$ x #Jz夌:07#ѤB|PXL&"P^˿vu߹O۫H>Y4 IO5a8$^q/Yj>x!T~ouV0 S֛[BRXJ{_Кz+lw4ov5:=z I vР|q -zOw,$+i{o8󿾇_㸼O}f6# s ȼYG| wcMɐ:i?7$pw"13U4RuE ^HZl?T9ʥKh f0XO+wP4'P_x =s9k^V dkg߻dE\Nt$ޞvLEO^vM5i`.{mK-n=äAAe4Hʢ<4,%ɨO"/ɺ(\r /;HL ?=}~@o`~á'$DyW^v LD{n\Mh!㜇Ρ$!p3ʼnZN6' ѣ;^kF*`GڔyS|bl[SGLu>15GcFSy10'یQVt *Vtr[-ﶢ3mEmEIۊf$V4V|mE3HۊIۊzO V)tM>۟k>@?̴l̻Z hUh@fA.(Q4 k2[3w05iRK.VUWqRM)}n'hUĴrj75VCP [~zE>_ f7e~mJ~=g#v)y7l rX!J8!=cYDRO! I}Q}Y,W)bH.ɚL%Gsnr9L;X1McBj !Gfs13ҲJT8$m۶|dVS]ӹ9f5]/3Z5o&:rxgv޻`m{5AߔP?air DnӨR@@]D$X],2Mbnuһ5Cj9_/jULYeդ9bJ: fE05gR4op:VۡZ>qՐg#Zó<<rilx|Tkz x!?:^ h%V8dK[X*[ yȰLϯr>;Gjx{V0ffUVY'~w\mUډ(B.@|8rhΦ76@#^G+-,~;{oA';71GQ$v:?\׵wǒ;iANG@Ӫ^B^eY'4e}^fŒz<شE2`qMli-C[8:@A폟{okV}6qXX E91TI4rR9D *l GsMǑ6װTS3y+vq zlSg9g4 :KNoA#̶UJv'5=1\f>m_Tg$1怕J|] _W!?~l_c\;o`fFTO7C-&h+'GMz)єUOΡxl ۑ#rX=~:x+*8F,nQ좋,+6z2+xTNT}q0yyƦ:o5I0H).fJMsik U5sC#=gٞţj'2BByǚbpW}.4x}@КQST83m֚UJ'ˏ,%rRǦ(SMu6Ǒ 6_{x˼IUX>'*2В%wȬ8,p-^523ήٚC8E/9p+P_yVX -:sP}AW{q37v Bxv2,0pH 5ءX]ljƶOJVro AܖY8}tV "J)~Xng.۲6R )?S/TF!wV}mb)xV_wi㟊73Ds]@6x:XI|ёk ~I3K)܊ 7x.3[m.=}J]>~n)yJe5/:Z;H;{񂠺~ٌ ֨٬ӨHĠ͓հIWμYm׼*ڨZiQArʤx_S> 430({vn 7sAQR0HP4J9 jf,u}(hu:<-Nc9L*W&9G2!ゟC3Ѡ^1` 8zqM8 7c?Qޯo@GLEgzUEȣT{AA!}T*3zˉ,ưGi"u2%Yo t|3Gr=-%&+.ad+.bv3 m6eB: 3b) {LGZ!y AcͭGGUy'I$&N t#61$A30ɐlAd1mƍNbZtmW)+]b REk5=hTZ_vu~w{3AoiΙ̻{wĽ޼x32GS~IOK7X2&maA8VBZ(F0`rWe{ч a=j~Sq)Py9!u{X38(NKT\ə<8 >O?dS1C@LpR-8rGFfq`s*aW?VRiYM 8pt9LLZ.КM_ 4aQ'Rw=$d ړIgÄMqs.m,A`u=n,@hrd,졬f6EsvdW3|zF /*e#SYC19hYȉj5G,DGpbv{Rщ,) zmiqʐle mO>dš= FpO`ZTZz[9 7h܃0ha)I<闿8Lu&GVUJvDgЅ^T]ZߑHCc؎R+)Ls}d%|aaaRD(O6L\te|\UCYsi'=^ QH|H/"y}z&5v曽WGѺKoUq)3 wY/"%kx:[BRI(O$A=:L{RإDt6PKXT+5WaqاTz`Rb[aڧA&c_t&Pgsv*L2aktnzRE:799=uRVnHn$'Pqņ!)a^ob|oCtNiAv^;ܫE"z>pRUCj~eMZQ2݁{ߟR/զHy]Z]z]P ,3SgނlX=J5ʏWU{N,TW_};)9]rWfpv®!ίNN?+8,A4Cʭ.0&я{25[2{OEʬhI 3Y ) n~Yh# THpX Hw@/!)FA|O4_%c_)hE2L#|xjlv\RˍwЂv-bZZ |7=km{ 5xbҴS՞dh $j0r*/N|F>^.vSكɣ$W@f^ ew1 +=$ҊA<>Z|V3 $p ?VcM{>WQa -. 9X<>Zp0$-61gheVĩzҋ\^@rx"zg@ì enP' i:!ՒͨXEEڙ&CLcp=G2 z*8O4/.~Ÿ^Jprw5yd= wܙ4vcm*%68+mXIWڰ\ H3":(J` z!)fN]/E7ss-hF(*d SFNGk7 %͕'D+G+to񪞍CD eD= ,+llnN =@n nd4,c9d'3xdF?9NdqDr|dQ`a)vAy^T "Hh!x(n& Yf z9hϑJ&KuܝZMIV3p%?@ƳeZCKW%<qo!$i|baW$w8tq!faWRY|2u"~C קLA'28givrPdFGP[andu~xʓ *F3|RoILW!]MCM{!@TC%? 4NI ZP<ŀnZePmany7oh,.,s EXm"9Ug "[N][Q[AI*cExrchmPCWz/2WuB|2d#(qkWFDY (uy_5YnVnEt'$a{>XW"N N`5yO=}P-'YA3*AȋHϹ'#DZKΒXx(:nyuH ߬M$il;2=A辷dhRϚO'c}96c1H>'>ҀDLւo'˂FQ=AuM-NAm$EG4n. 1U&ReAd\?, 뱻ˏGDVI<^&ˆXk95NBWFq-6 Cp 7> TtW`\13x:B95;`vq/ 2e dunTFiJdwiXOi -. ,UGz͈Z!S%,al9r ӒӢԑƈPnnn!=4_,T}iISeLƨ8@ j6Լrt$YKYE(m $Ch7 tt!VCnND+PNKԦiΠWvMSshk4l uP=:n$ xf JAfVcǕLB"f!h<'$3=Nl4-|uQ =V@m],u!\p|Ԣ`_PVkE,$"rG=4D^40;Iߝ,uyR3}SWDfٗ& _k8-og#2UҬ9l*i ɧyhASE#<ڹ2 Éa ǁ|i=S[Fύݺs #.VuOWy[Ƶ0F i,2+n_R>~Ο?(WT(_y߿Gqqb5b6`,[ǵ@+ b^@Qc9滠pFBAîw5WL@Qk8BƄR^I<^㔠dp~O,PD1Z= HETˣHd+Dx̀wHqHQ :1nPC1x`'bEQݒFU s jRj9Cy]N5P Mq6KLd-=$fq6C7au -p;(ǍXObaeX(~#s/Z)II>abʳrf6Ls: yH>\7lrY5 tPpC|r}%d78@6C.up~*?8\<Y2-HCgd-vSCz4ʡ_+!&rx3PO i@*HOWf'F:f1/*2e tP>A*b<G±7e>?0cl9{È礩a| loBHwpvD:q 䓗2 DP"J^L ;$a<:0.Gtr4a" ~Vg.Ӑ;gȶS j0ӌ hQc$qyx4p^l6vVyD.H/S؎i ;%j6em7M?]E$ދ0\n?0ƒ:\Ѝ$HB û6&Μ1kGXz>ĥKasx$GY<n xԂhO11;_ XD\ )~i%qrn 5gZO|9&# Hoj-eٙ7ܦP[@uT/Puz,dO]@=ڟjv V6)B}.2|-`]ؿPD(V Yu#徲H|FD\ vy7.@12-֖z_t+BgX~-,ŪJVxBxGpjs^#Sq TW (.f_9EDДg 6&VKq_oF.-y@Nvh_ր)i^P )^˲ L+ Ъ§{vaD}Wm ~Xg}5W6aMqz(Z߰u] S Z .cKhwŘ O<3eھ=O@^xoeCPv[bJZ-:%7-|Qw,Xev\wݲvW릭 7n *M~u[,V$E5][avX:,c$ w,_ro(QM?ocK>ȗPOomwWw_zI٠;Y.7|A/ȗ |{Aoشp,DCK= tTUB0"KAo5H"d@H* J6@hhv+jO2vksnQt s}ך}f?u߿/83u9(?]W9eu0,2W*v.iz|D"I: I @$wLKHiF %&peщ Q=2JYMn%&IىBpҼ6ܤ)wR]Ut9;^xF$2x*r'h P|HM=v߉'1F] }6 r*Tz>xQa)?gn68iFUA ZJ *+"@8<R rwGr&{tP lp@nĎɿhۑnm +po&y"PzYfVY 3--ՃzInڳmP-gBZY5h:ߔ` ׅen:3%7EpPq:mG򺌜Kak&`[YZ[j5MCG-zrKG#߹k'TbĚ )Gnc@=NJ G,z(?(yq!EXlȍ IIZdĶe\&*p0s) 3 nieOIN [])3*u7KDeP %Nu\H5$Qtqlu+[ dbU*d&{ڔB.cQ{<^g0ʋv~bm5Ռets D8flYL%Xэ$ƍxq#,+๴F5C(e+ݿ(t eJCK ;ٶچm/AmEi&P^2 ,x۸юm zR 4 f s>KJ+wqceF :x_G\*Iz;h hE~r{,z!niPxmm%msV~ !EL$C@ͷm*_[ݍnBZ=Lu?91q p㼆Oۣh '.QDql0d·aO=c 7ûXnd~ӳD^BQΌ=,Wtx&4(}\r-Nh\RbHiYN c(B럏vߧK[jK<'zRԊIsqly^右 #sԉYB9QIerT in6J&,퇵A/Qu;l.[7ʳFyma\0?gɪpnK߫Q)3ʵbImDz6HuSOϠCF(< W"|S@o!:k==S%<#ԯ$lff<-nD]b<$Ľ{ycN }e3@!Gc;keQzI',ܣƸbLT&g\B>ձ8aEk._h{Wӳ;%!Z#J3*f'Vɨ9-8eO9|m֮ŵemvvvvh>о9>dtݭ-R֧3 PO+55&}~X/5N34jFh7V?56fi_*%YʚRV(Ierrr ezxq *lo.^$ *վ|O}s/JCW#AO4ppi9buACݧʵj-XA WIj!]4&uF¸ָq94<3jT/7655wgYUk,e4**<. r/4qxxH҅RQ[rLRS_.?)HA,VU6)*w)(C@2>}{[;ۧ|7+Q". \!ぽ % ۃ[A2ԑ8UTMj@]&e5 m=VuGzPT=GTmvp:av,Ai%u10 &~!)yTS.0*syg Xiy ֯{k~}Ng0] W _ ۄG?a♢ үbD ~q8LiHKK>Y* |A#TE~Z!%QNVTe2M ) +ߔ>^ww3xK|xXtI}2iG׃;.itD*˃ryZuroeR\t*? :xx\owwW>W 聩@{`f2o? V:K;Gk(X[ݥݧ=vV u>,oҽz1fm+cyAT\cǒkn޲>t,!a%4 ee‰Au*y"n,ń?tŎRJc2]%C>AHuZv5Qi:.8!>'s9"o<_ӋUN|;Iq*VI~ B6:Zk)Mg8n1GE^mR] O9iA!`/} 82!7&(\WOIttMJ^0}[/B_6;EHm}4cqlLAFGѮ}7;l}8i)Whe4y#Ӹ;~a f'Rg`[s Lv(O,ef`^5fܿW!dqܙnKpg6or\`;ͣ`lf]NS}.&|!Σ us7,~>uG?@譎G7%ܝ"w8u$Qw+n+5uD*j5^{IpE7ܗ m 'vݲt' #|no\$^ \IFr$z X!BBo\+LF95t*ĤB\%^!^+1XG']&umxG%/#dLo%d?q7.0K-פApwJ/Qu\tqLm8b8IR*vYU.ЪM sUOm§%i1_̦#- Wg: = |J̧A[MSj7M1rbD>W⑳{K XN*K@[D`CS+ iѪͬ+6R谛Ւ ]HNbb\"O` P?q}^Æ0 2:k|P61„ }ƨ{9sssn\>J'}eDmeq# 19>ίrUm#+ҍ^nAKbGDGmV393PW:({Ĉ(AK8t-GA,ḣCv7߀0__lnl_١rĮ866!Xd /m>T,BV_XQ0[X/]:')6 @hȕsnBc@n)6f"*Y;ˡAِ퇵-μg[|@K~N+Z'd]nXF?WF7KbMɑ!_ŒdTM" @æEP<|PQdFsJtzo\|"Dl~nnOE;O6.;RB{F?~a)J+U8/ȧ\2Ox(LRHScPPSWFlash.infMacromedia Flash Player 6PAWould you like to install the Flash Player 6 ActiveX control?PAP (PA4VS_VERSION_INFOGG?HStringFileInfo$040904B0LCompanyNameMicrosoft CorporationHFileDescriptionWin32 Cabinet Self-Extractor 8 FileVersion4.71.0410.0RInternalNameWextract j#LegalCopyrightCopyright (C) Microsoft Corp. 1995ZOriginalFilenameWEXTRACT.EXE x,ProductNameMicrosoft(R) Windows NT(R) Operating System< ProductVersion4.71.0410.0DVarFileInfo$Translation PADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXXPADDINGPADDINGXL5P5??? d0 0*090R0y00000001'1<1D1g1 22/2N2222222223-343C3Q3V3[3a3n3y333333333334 44F4M4^4m4{444444 55"5G5N5l5s55556'6;6O6Z6c6m6w66666666677)7:7D7T7u7|77777777788/8=8J8S8`8y8888888 9+9@99999999 :4:O:_:::::::6;<@y>> ?,?5?=?H?S?X?z???????????0 0+0F0K0U0b0n0000000001 11#1,1B1L1111112$2:2F2L2T2k2222223+313:3I3X3b3g3p3y3~33334*414I4P4e4l4444455B5K5`55555555556Q6_6h6n6|66667772787G7e7l777777777777788&8-83888I8T8[8g88888 9?9V9b9g9o9999;+;5;>;f;;;;;;;;;; <<<#<*<=>>9>F>c>>>>>>>> ??0?E?Q?e?l?s?????????@0D0d00000000 111)12181K1f111111112#2,2=2S2f22222222 3393M3U3a3h3r33333333?4X4p4|4444 55J5T5l5x555555566686A6R6\6e666666677 7E7r777777777&868H8_8s8}88888879[99999::!:::@:F:L:V:\:b::::::::;;.;=;d;j;|;;;;;;;;;;;;;<#<<r>>>>???)?7?Y?^?c?h?m?r?w???P 00%0,080?0D0U0o0v0{0000000000000 11!1(1.1:1R1[1e1r11111111111112 2%2/2^2q2222222233353A3J3Z3b3m3t3333333333334(454I4P4c4r4~444444445 5'5.535=5B5Q5W5\5o5y55555555556#6E6K6[6b6l6w6}666666667C7Q7W7q777R8W888888(9l99999991:;:[:{:::::;);<;I;l;;;;;;;< >>>!????` 0"0'0:0I0N0h0000%131I1^111111112 222$2c22222223)303A3N3U3p3333334)4T4o4~44444445#5C5L5|55555555556666Z6_6i6s6667r77"9A9]999999+:::!;,;1;>;C;;;;;;;;;;;<<<.<9<<>>>*?G?e???p  0,0[0d0i0o0z000;11b22222223b333333 424r44444585H5Z5|55555555666<66666666667 777747A7F7L7Q7777788:8j8t888889=9D9X9]9~9999999:::6:K:P:e:l:a;p;;;;;;;;<&>>>>>?0?J?Q?h?o?v??????020B0Q0Z0y00000001!1`1z11129222222223353P3n3333d4v4~44444445(5T5j5556~66667H7Y77777777777788$8-888889 99959<9D9X999:1:T::::;;;;#<5<<<>>>>? ???#?+?0?B?L?d?000000011"181F178 8838G8Y8g8u88888888888888999!9/9=9N9T9Z9j9r99999999:b:::::::::; ;;; ;&;4;E;];>>>>*?0?6?>?M?T?[?k???????00001 11$191L1T1j111122 222i2222223+33o44444"515R5j5o55555 646R6a6666666'7J7u7777@8w888888899:K:b::::u;;;; < ==T=^===h>?J?f?080P0001x11112/2w2222263H3q325d6677777779999999d:h:l:p:t:=X====>X?b?r?y????????????????00#0-080@0L0U0]0c0k0q0v0|0000000000000001'1-161<1B1N1V1d1q1z1111111112,2S2e2v2222222222223 3B3b3m3z333333333334474=44444444444455)585C5R5]5s5x5~555555555555556656;6I6Q6b6h6w666666666 77"7(707C7J7j7q77777D#>)>@>J>P>U>[>f>>>>>>>>?Z?`?p?w?}???"0(080?0E0P0r00001 111>1\1}111111111 222"2(2.292I2S2y2222222222$3*3:3A3G3R33333333444*474=4H4444445 5.5<5B5M5f5z55555556V6\6l6t6z66666777"7:7777777788 828788888889939:9@9E9n9t9z9999999999:::&:,:7:h:|:::::::::::::::;;3;:;J;P;`;h;n;y;;;;;;;;;;=_=f=m=s=========>>>>:>@>J>e>q>v>{>>>>>>>>>>>??"?'?,?1?>?K?i?`t000000000 11&1-1<1C1V1o111111111122%262A2W2^2m2t222222222 33#3<3O3Z3n3y333333333 4"414<4Y4`4o4v44444444455+525E5^5q5|5555555556$6/6>6T6c6p6t6x6|66666666666666666777%7.7d7l7s7y7777777777778%838D8c8~8888888888888888 999#9+91979=9L9[9l9r9x9 00 `x000555556 666$6,646<6D6L6T6\6d6x66666666666666666788$88800H1P1X1`1h1p1x111111111111111112222 2(20282@2H2P2X2`2h2p2x222222222222222223333 3(30383@3H3P3X3`3h3p3x333333333333333334444 4(40484@4H4P4X4`4h4p4x444444444444444445555 5(50585@5H5P5X5`5h5p5x555555555555555556666 6(60686@6H6P6X6`6h6p6x66666666666666666777@9H9;;;;;;;;;;<<< <<<<< <$<(<,<0<4<8<<<@O O|Q=QVR+SASBӯT"KU;F Y Y{y\+]&EQbOAbRb c ӾcG dCӟdbB erseB&gpg*gh` i in i j  k0PkpkkPl `l pl mOn/o o:`oPppr Pt#vMv_0w,`w pwPy`yyo@z9`{={j~~*@+ p,`#m JpSІp ^P 0QFz`|0t 3C`PO Cf` >`  . P? `<@d  s p `?_x0 0n09p J`a в({P@ lP  o5 f 0`y PPiV0{P @S00eZ "P A&5"@sp >Ga @VB` 0"` 0Pp @/ I